KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_4254Help
Entry
XNC1_4254         CDS       T01274                                 

Gene name
ampH
Definition
(GenBank) beta-lactamase/D-ala carboxypeptidase, penicillin-binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
KEGG Orthology (KO) [BR:xne00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xne01002]
    XNC1_4254 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xne01011]
    XNC1_4254 (ampH)
Enzymes [BR:xne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XNC1_4254 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     XNC1_4254 (ampH)
Peptidases and inhibitors [BR:xne01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   XNC1_4254 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:xne01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   XNC1_4254 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CBJ92276
UniProt: D3VE25
LinkDB All DBs
Position
4093100..4094317
Genome map
AA seq 405 aa AA seqDB search
MKKKLYKLCAVSALTWAISACADSGDSHQNKFQQSNAQPAKWEVLAANDNIKKMATVLVD
QYSQSIFNEGKPLGMAMVVIDNNQVVHRSFGETHLGSGVKPRQDSLIRIASITKLMTSEV
MIKLAQKERIKLTDPLQKYTYYGINVPDYGVGQPIRLYHLASHTSGLPREQPGGKWGRPV
FIWPTQSNRWTWLKTAGLNAVPGTTASYSNLAYDLLADALSKATGEPYARLLQQEITRPY
RMKDTTLSPTQSQCARLMEGIKPSPCVNTIAAAGSGGIYSTPADMQRWMQQFLSSQSQLR
KQTASREQGIYFKRSDLKSIKGMDVAGLANGIGLGWVYMDAKDDIPGIYQKTGGGGGFNT
YMAMIPERNIGVFVVMTRKEQSQFSRVTNGVNELVAALSRNHNQI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaagctatataaactgtgtgcggtttccgccctgacgtgggcgatttcggct
tgtgctgattctggcgattcacatcagaacaaatttcagcagtccaatgcacaacctgca
aagtgggaagttcttgcagctaatgacaatatcaagaaaatggccacagttcttgtcgat
caatattcacagtccatctttaatgaaggcaagcctttgggaatggcgatggtggtgatc
gataataatcaggttgtgcatcgcagtttcggggaaacacatctaggcagtggcgttaaa
cctcgtcaggattctttgattcgtattgcttcgattaccaaattgatgaccagtgaggtc
atgatcaaattagcccagaaagagcgcattaagctgaccgatccattacagaagtatact
tattacggtattaatgtaccggattatggcgtgggtcaaccaatcagactgtatcatctg
gcaagccataccagcggattgccacgagagcaaccgggcggaaaatggggacgtccggtg
tttatctggccgactcaatcaaaccgctggacttggctgaaaaccgcaggattaaatgca
gttcccggcacaacggcatcgtattccaatctggcctacgatttattggcagatgcactt
tccaaagccaccggagaaccctatgcccgtctcttgcagcaggagataacccggccttat
cgcatgaaggatacaacgctgtcgcccacgcaatcccaatgtgcccgtttgatggaagga
attaaacccagcccttgtgtgaataccattgccgccgctggcagcggggggatttattcc
accccggcagatatgcagcgctggatgcagcagtttttatcttcccaaagtcagctaagg
aagcaaactgccagtcgtgaacagggcatttactttaaacgctcagatttgaaatcaatt
aaagggatggatgtcgctggtctggcaaatggtatcgggctgggttgggtgtatatggat
gctaaagacgatatccccggaatttaccagaaaaccggcggcggcggcgggttcaatact
tatatggcgatgatccctgaacgaaacatcggtgtgtttgtggtgatgacccgcaaggaa
caaagtcaattcagccgcgtaacgaatggggttaatgagttagttgcagcattatcgcgt
aatcataatcagatttaa

DBGET integrated database retrieval system