KEGG   Xenorhabdus nematophila AN6/1: XNC2_0296Help
Entry
XNC2_0296         CDS       T03752                                 

Gene name
tufB
Definition
(GenBank) putative protein chain elongation factor EF-Tu; GTP-binding factor (duplicate of tufA)
  KO
K02358  elongation factor Tu
Organism
xnm  Xenorhabdus nematophila AN6/1
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:xnm03012]
    XNC2_0296 (tufB)
   03029 Mitochondrial biogenesis [BR:xnm03029]
    XNC2_0296 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xnm04147]
    XNC2_0296 (tufB)
Translation factors [BR:xnm03012]
 Eukaryotic Type
  Elongation factors
   XNC2_0296 (tufB)
 Prokaryotic Type
   XNC2_0296 (tufB)
Mitochondrial biogenesis [BR:xnm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    XNC2_0296 (tufB)
Exosome [BR:xnm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XNC2_0296 (tufB)
  Exosomal proteins of breast cancer cells
   XNC2_0296 (tufB)
  Exosomal proteins of colorectal cancer cells
   XNC2_0296 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CEK21298
UniProt: A0A0R4CWB1
LinkDB All DBs
Position
I:258327..259511
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVLVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
DEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgctgcaatcaccaccgttctggcaaaaacctac
ggcggtaacgcgcgtgcatttgaccagatcgataacgcgccagaagaaaaagcgcgtggt
atcaccatttctacttctcacgtagaatatgataccccaactcgccactacgcacacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcacgggtgcggcacagatggat
ggcgcggttctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgctgggccgtcaggtaggcgttccatacatcatcgtgttcctgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagtccgtgagctgctgtctcag
tacgatttcccaggcgacgacacgccaatcatccgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggctgaagcactggattcttacatc
ccagaaccagagcgtgacattgacaagccattcctgctgccaatcgaagacgtcttctcc
atctccggccgtggtactgtagttaccggtcgtgttgagcgtggtatcgttaaagtgggc
gacgaagttgaaatcgtgggtatcaaagaaaccaccaaaacaacttgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgttggtgttctgctgcgt
ggtactaagcgtgacgaaatcgaacgaggtcaggtattggctaaacccggttcaattaag
ccacacacccagttcgaatctgaagtgtatatcctgagtaaagatgaaggtggccgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaaccggt
actatcgaactgccagaaggcgttgagatggtcatgccaggtgacaacatcaacatgatc
gttagcctgattcatccaatcgcaatggacgaaggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggtgctggtgttgttgctaaagttattgcttaa

DBGET integrated database retrieval system