KEGG   Xenorhabdus nematophila AN6/1: XNC2_0876Help
Entry
XNC2_0876         CDS       T03752                                 

Gene name
mrcB
Definition
(GenBank) bifunctional penicillin-binding protein 1b: glycosyl transferase (N-terminal); transpeptidase (C-terminal)
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XNC2_0876 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xnm01003]
    XNC2_0876 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xnm01011]
    XNC2_0876 (mrcB)
Enzymes [BR:xnm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     XNC2_0876 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XNC2_0876 (mrcB)
Glycosyltransferases [BR:xnm01003]
 Polysaccharide
  Bacterial polysaccharide
   XNC2_0876 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:xnm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   XNC2_0876 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM UB2H Transpeptidase UvrB_inter Orf78
Motif
Other DBs
NCBI-ProteinID: CEK21872
UniProt: A0A0R4FK44
LinkDB All DBs
Position
I:complement(764526..767003)
Genome map
AA seq 825 aa AA seqDB search
MSDDDRQPIGRKGKKSGLRRGRASKNRVRQDDYDDYENDDFDDDDEDEVMTKKGKNARSP
KSRSSKNRGNWILWFLLKVFIVLAVIIVAYGFYLDNKIRQRIDGKVWDLPAAVYGRVVNL
EPGMNYSRDEMIQLLEGMQYRKVTKITRAGEFVLKGNNIELLRRSFDFPDGQENQIQARL
SFENNHLTRIENVENQRQFGFFRLDPKLITMMQSANGEQRLFVPREGFPDSLVHILLETE
DRYFYEHGGVRPISIIRAVLANLTAGRAVQGGSTLTQQLVKNLFLSNERTLTRKANEALM
AVLMDARYSKDRILELYLNEVYLGQSGDEQIRGFPLASQYYFGSPISELTLDQQALLVGM
VKGASVYNPWRNPKKALERRNIVLKILQNRNVITQKDYDLLSVRSLGVKPKSESITPQPA
FMQLVRQELQEKLGDKVNNLSGVKIFTTLDPVSQDAAEKSVEEGVAELRKARNIADLEGA
MVVVDRISGEVRAMVGGSQPQYAGFNRALNARRLIGSLAKPATYLTALSQPDKYRLNTWL
ADEPLSVPLAGGKTWEPRNFSRNFSGRLMLVDALARSVNIPTVNLGMDIGLDHITSTLVS
MGIPAQEIKQVPAMLLGAIALTPMEMAQEFQTIASGGNRAKLSALRSIMAEDGTVVYQSY
PQAERAVPPQAAYLTLYGMQQVIARGTGRSLTGKYGQYNLAGKTGTTNDLRDSWFTGIDG
KEVAIVWTGRDNNGMTNLTGATGALTIYKRYLENETPLALNNRPPESIVDMSVNEDGSFN
CVGTGIRTLPVWTDDPQSLCQQPVQQPIEDNEEEAPGWLREMFSQ
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgatgatcgtcagccaatcggacgcaagggtaaaaaatcggggcttcgtcgt
gggcgagcatcaaaaaatcgcgttcggcaggatgactatgatgattatgaaaatgatgat
tttgacgacgacgatgaggatgaagtgatgaccaaaaaagggaagaatgcccgctcaccg
aagagccgatcttccaaaaatcggggaaactggattttgtggtttctactaaaagtcttt
attgtgttggcagtgattattgttgcctacggtttttatctggataacaaaattcgtcag
cgcatcgatggtaaagtctgggatttgcccgccgcagtatatggtcgggtggtcaatctt
gaaccgggtatgaattacagcagggacgaaatgatccaattgctggaaggtatgcagtac
cggaaagtgacaaaaataacccgtgcgggtgaatttgtactcaagggaaacaatattgaa
cttctgcgtcgttcatttgatttccctgatggtcaggaaaatcagatccaagccagattg
tcctttgaaaacaatcatcttacccgcatcgaaaacgtagaaaaccagcggcaatttggt
ttcttccgtcttgatccaaaactgattacgatgatgcagtcggcgaatggcgaacaacgt
ctgtttgtcccgcgtgaaggttttcctgattcactggttcatattttgctggaaacagaa
gatcgttatttctatgaacatggcggagtcaggccaatatccattatccgcgctgtattg
gccaatttgaccgcgggacgtgctgttcagggaggcagtacgctgactcagcagttggtg
aaaaacctgtttctctccaatgagcgtactttgacccgtaaagcgaatgaagcgctgatg
gcggtgttgatggatgcacgttatagcaaagatcgcattcttgaactgtatttgaacgaa
gtctatttggggcagagtggcgatgaacagatccgtggcttcccgttagcgagccagtac
tactttggcagtccgattagtgaattaacgctggatcagcaggctttgctggtggggatg
gttaaaggggcatcggtatataacccgtggcgcaatcctaaaaaagcactggaacgccgc
aatatcgtgctgaaaattcttcagaaccggaacgtcatcacgcaaaaagattatgacttg
ttgagtgtccgttcactgggcgtaaaacctaaaagtgagagtattacgccacaacctgcg
tttatgcagttagtgcgtcaggaattacaggaaaagttaggtgataaagttaataacctg
tcgggtgtaaaaatcttcactaccttagatcctgtttcacaggatgcagcagagaaatcg
gtggaagaaggtgtcgctgaattgcgaaaagcgcgcaacattgctgatctggaaggtgca
atggtggttgtggatcgcatcagtggtgaagttcgtgcaatggtggggggttcccagcca
caatatgcaggatttaaccgggcattgaatgcccgccgcttaatcggttctttagctaag
cctgcgacttatctgaccgcattgagccagccagataaatatcgcctgaatacctggctg
gcggatgagcccctctctgtcccattggcaggagggaaaacatgggagcctaggaacttt
agccgtaatttcagcggccgattgatgttggtcgatgctttggcgcgttcggtaaacatt
cctaccgtcaatctggggatggatattggattggatcacattaccagtacactggtttca
atgggcattcctgcgcaagaaatcaaacaagttcccgctatgttgctgggcgcaattgcg
ctgacaccaatggaaatggcacaagaattccagaccatcgccagcggcggtaatcgcgca
aaactctctgcactgcgctctatcatggctgaagacggtacagtggtttaccagagctat
ccgcaggctgagcgggctgtaccgccacaggctgcctatctgacactgtatggtatgcag
caggtcatcgcacggggcacaggccgctcactgacgggtaaatatggtcaatataattta
gcgggtaaaaccggaacgacgaacgatctgcgtgacagttggtttacgggcattgatggt
aaagaagtcgcgattgtctggaccggccgcgataacaatggcatgaccaatctgactggg
gcaaccggcgcattaacgatctataagcgttatctggaaaatgaaacgccattggcgctg
aataaccgtccgccggaaagcattgtagatatgtcagtcaatgaagatggcagtttcaac
tgtgttggtaccggcatcagaacgttgcctgtctggacagatgatccacaatctttgtgt
cagcagcctgtgcaacagccgatagaggataatgaagaagaagcgccgggctggctgcgc
gagatgtttagtcagtag

DBGET integrated database retrieval system