KEGG   Xenorhabdus nematophila AN6/1: XNC2_1502Help
Entry
XNC2_1502         CDS       T03752                                 

Gene name
cydC
Definition
(GenBank) cysteine transport (export) protein (ABC superfamily, membrane (N-terminal), atp_bind (C-terminal))
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    XNC2_1502 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xnm02000]
    XNC2_1502 (cydC)
Transporters [BR:xnm02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    XNC2_1502 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 NACHT AAA_16 DUF87 RsgA_GTPase MMR_HSR1 AAA_30 AAA_22 AAA_5 AAA_29 AAA_7 RNA_helicase AAA_18 AAA_23 AAA_25 DUF815
Motif
Other DBs
NCBI-ProteinID: CEK22496
UniProt: A0A0R4CNT2
LinkDB All DBs
Position
I:complement(1423419..1425161)
Genome map
AA seq 580 aa AA seqDB search
MRILFPFLTLYRRHWFLISLGMVLSIVTLLASIGLLTLSGWFLAGTALAGFAGLYTFNYM
LPAAGVRGAAIFRTAGRYGERLVSHDATFRVLAHLRVFAFKKILPLSPGGIARFRQGELL
NRLVADVETLDHLYLRVISPVLAAFVVILVLTFGLGFLDITLAYTLGGIMLGLLLILPFM
FYYAGKPYGRNINLQRAQYRTLLTSALQGQAELTVFGSLKRFRQSMAEVELDWLRSQQKQ
ANLTGLSQAIMIFATGMAVTLMLWLAAAGIGENSQPGALIALFTFCTLAAFEALGPVTVA
FQHMGQVISSATRISQLTHQKPEVLFPSHGAKTYGELSLEIKNVDFTYPDQPLPVLKNIS
LSLASGEHIALLGKTGCGKSTLLQLLTRAWDASHGKIQLNQKSISDYDEATLRSMMSIVP
QRIHVFSHTLRENLLLAKPDANDDELITVLKQVGLGNLLDTDEKLNCWVGEGGRQLSGGE
QRRLGIARALLHDAPLMLLDEPTEGLDADTEQQILSLLRHSCQNKTLITVTHRLTGLHHM
ERICVMDGGRIIEQGKHDVLLAQQGRYYQFYQRQHYPQQA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatactatttccatttctcaccctctatcgccgccactggtttctcatcagttta
ggaatggtattgtcgattgtgactttgttagccagtattggtttgctgacactttctgga
tggttccttgccggcacggctctggcaggatttgcgggattatatacatttaactatatg
ttgcctgctgccggcgttcgtggtgcggccattttccgtacggcgggcagatatggtgag
cgtcttgtgagtcacgatgcaaccttccgtgttttagcgcacttacgtgttttcgctttt
aagaaaattctgccactttctcccggcggaattgcccgttttcgccaaggtgaattgttg
aacagacttgttgccgatgtcgaaacgctggatcatctctacctacgtgttatttcccct
gttctcgctgcatttgttgtgattttagtgctgacatttggcttgggttttcttgatatc
acactcgcctatactctcggcggtattatgttagggttactgctgatattacctttcatg
ttttactatgctggaaaaccttacggcagaaatatcaatctacaacgagcccaatatcgt
acattacttaccagtgccttgcagggacaagctgaattgaccgtattcggttcacttaag
cgttttcgtcaatctatggcagaagttgaacttgattggttaagaagtcagcaaaaacaa
gctaatttaaccgggctatcacaagcaatcatgattttcgctaccggtatggcagtaacg
ttgatgctttggctggcagccgcaggtataggggaaaacagtcagcctggcgcgttaatc
gctttatttacattctgcactctcgctgcttttgaagcccttgggccagttactgtcgca
ttccaacatatgggacaagttatttcatctgcaactcgtatttcccaattaacgcatcaa
aagccggaagtgctcttcccttcccacggagctaagacttatggtgagctcagtcttgag
ataaaaaatgttgatttcacctatcctgaccaaccattacccgtattaaaaaacatttct
ctctctttggcatcaggtgaacatattgctttattgggaaaaacaggatgtggaaaatcg
actctgttacaattattgacccgcgcatgggatgccagtcacggtaagatccaactcaat
caaaaatctatttccgactatgatgaggctacattacgctcaatgatgtctattgttccg
caaagaatacatgtattcagccatactctacgtgaaaatcttttattggcaaaaccagat
gccaatgacgatgagttaatcactgtactgaaacaagtcggtttaggaaacttgctggat
actgatgaaaagctaaactgttgggtgggtgaaggcgggcgccaactttccggtggagag
caacgccgcttaggaattgccagagcattgctacatgatgctcctctcatgcttctggat
gaaccgacagaaggacttgacgcagatactgaacaacagattctatcgctgctacgccat
agctgccaaaacaagacactgattacggttacccatcggctaacaggtttacatcatatg
gagcggatctgtgttatggatggaggacgtattattgagcaaggcaaacatgacgtattg
ctggctcagcaagggcgttattatcaattttatcaacgacaacactatcctcagcaggcg
tga

DBGET integrated database retrieval system