KEGG   Xenorhabdus nematophila AN6/1: XNC2_1822Help
Entry
XNC2_1822         CDS       T03752                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, iron
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xnm  Xenorhabdus nematophila AN6/1
Brite
Enzymes [BR:xnm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XNC2_1822 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CEK22816
UniProt: A0A0R4CP38
LinkDB All DBs
Position
I:complement(1801341..1801919)
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLEYHYGKHHNAYVVNLNNLVKDTELAGKSLEEIIKTS
EGGIFNNAAQVWNHTFYWHCLSPNGGSEPTGKVADAINSAFGSFAEFKQQFTDAALKNFG
SGWTWLVKKTDDNLAIVNTSNAATPLTGEDKPVLTVDVWEHAYYIDYRNARPQYLEHFWA
LVNWKFVEENLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccagcattaccttatgccaaagatgccttggaaccacacatttct
gcagaaaccctggaatatcattacggcaaacaccacaatgcctacgttgtcaatctgaac
aatttagttaaagataccgaacttgcagggaaatctctggaagaaattatcaaaacatct
gaaggcggcatcttcaataatgcagcacaggtctggaatcatactttctactggcactgc
ctgtcacccaatggtggcagcgaaccaaccggaaaagtagcagacgccattaacagcgct
ttcggttcttttgctgagtttaaacagcagtttactgatgctgccctgaaaaactttggt
tcaggttggacatggttggtcaaaaaaactgacgacaatctggctatcgtcaacacctct
aatgcagcgactccactgactggcgaagataaacctgttctgactgttgacgtctgggaa
cacgcgtattacatcgattaccgtaatgcacgtcctcaatacctggagcacttttgggct
ttagttaactggaaatttgttgaagaaaacctggcttaa

DBGET integrated database retrieval system