KEGG   Xenorhabdus nematophila AN6/1: XNC2_3053Help
Entry
XNC2_3053         CDS       T03752                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm00061  Fatty acid biosynthesis
xnm00780  Biotin metabolism
xnm01100  Metabolic pathways
xnm01212  Fatty acid metabolism
Module
xnm_M00083  Fatty acid biosynthesis, elongation
xnm_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XNC2_3053 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    XNC2_3053 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xnm01004]
    XNC2_3053 (fabB)
Enzymes [BR:xnm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     XNC2_3053 (fabB)
Lipid biosynthesis proteins [BR:xnm01004]
 Fatty acid synthase
  Component type
   XNC2_3053 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: CEK24047
UniProt: A0A0R4CYW6
LinkDB All DBs
Position
I:complement(3119928..3121142)
Genome map
AA seq 404 aa AA seqDB search
MKRAVITGLGIVSSIGNNQKEVLESLKEGRSGITFSEKFKEMGMRSHVWGDIKLDTTGLI
DRKIQRFMSDASVYAYLAMDEAIKDSGLSEEHVSDLRTGLVVGAGGGSPYYQVAGADGMR
ARGLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGKQ
DVIFAGGGEELSWELSCEFDAMGALSTKYNETPQQASRTYDQNRDGFVIAGGGGIVVVEE
LEHALARGAHIYAEIIGYGANSDGADMVAPSGEGAVRCMRMALDGIEGGVDYINTHGTST
PIGDLKELEAIREVFGDDTPAISATKAMTGHSLGAAGAHEAIYSLLMLEHGIIAPSINIE
DLDEKAAGMNIITEPTKRELRTVMSNSFGFGGTNASLVMRKYSD
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtaatcactggtctggggattgtttccagtattggtaataaccagaaa
gaggttctggaatctctgaaagaaggtcgttcagggataactttctcagaaaaatttaaa
gaaatgggaatgcgaagccacgtatggggtgatatcaaactggatacaacaggtttgatt
gatcgaaaaattcaacgtttcatgagtgatgcttctgtttatgcttatctggcaatggat
gaggcgattaaagattcaggattgtccgaagaacacgtttctgatcttcgtactggcctg
gtggttggtgcaggtggtggctctccctattaccaggttgcgggtgctgatggtatgcgt
gctcgtgggttgcgtggcgtcgggccttatatggtcactcgcgcaatggcttcgggtgtt
tcagcttgtttagcaacgccttttaaaattaagggcgttaactattctatcagttctgct
tgttcgacttctgcacactgcatcggtcatgccgttgagttgatccaactcggtaagcaa
gatgtgatttttgctggcggcggtgaagaattaagttgggaactgtcttgtgaattcgat
gcgatgggagcgctgtccactaaatataatgaaaccccacagcaagcttctcgtacttat
gatcagaaccgtgacggtttcgtgattgcagggggcggcgggattgtcgttgttgaagaa
ttagaacacgcattggcccgtggcgcccatatttacgctgagattattggttatggtgcg
aattcagatggtgccgatatggttgcgccttctggagaaggcgctgtacgctgtatgagg
atggcgttagacggcattgaaggtggtgtggattatatcaatacccacgggacttcgacg
ccaatcggtgatttgaaagaattagaagccatcagagaagtttttggtgatgatacaccg
gctatttctgccactaaagcgatgacagggcattcattaggtgcggctggtgcccacgaa
gcgatttatagtttgttgatgctggaacatggcattattgctccaagtattaatattgaa
gatctggatgagaaagcggcaggtatgaatattatcactgaacctaccaaacgcgagcta
aggacagtgatgtccaatagcttcgggtttggtggtacaaatgcttccctggtgatgcgc
aagtattcagactaa

DBGET integrated database retrieval system