KEGG   Xenorhabdus nematophila AN6/1: XNC2_4060Help
Entry
XNC2_4060         CDS       T03752                                 

Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm00473  D-Alanine metabolism
xnm01100  Metabolic pathways
xnm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xnm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XNC2_4060
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    XNC2_4060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xnm01011]
    XNC2_4060
Enzymes [BR:xnm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     XNC2_4060
Peptidoglycan biosynthesis and degradation proteins [BR:xnm01011]
 Precursor biosynthesis
  Racemase
   XNC2_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C UBA_2 zf-XS
Motif
Other DBs
NCBI-ProteinID: CEK25047
UniProt: A0A0R4CZW7
LinkDB All DBs
Position
I:4054834..4056066
Genome map
AA seq 410 aa AA seqDB search
MRLNKTTLAILLGLSLYQGAAQAAPVLSSDNTQAKRVAAHNNAWVEINTTTFENNIHILQ
QKLNRNTKMCAVLKGDAYGHGIGLLMPSVIKTGVLCVGITSNEEARIVRESGFKGQLIRI
RTADVSEIESTLGYDMEEIIGDLAHAKTVADLAKKHGKEIRVHLALNTGLMSRNGLEMKT
EQGKQEALKMTQLPNLKLVGIMSHHALTDLDAIRDSIKNFNEQTAWLIKAANLKRDEITL
HASSSFASVSIPEAQFDMVRVGSALYGILTNTHPEFKPLIQVKTHVASVKSYPKGNGVSY
NNTYILKRDSKLANLPVGFSDGFSSSLSNKAYVLINGHRAPVVGSVSMNTVMADVTDLPE
VKSGDEVVIFGKQGNEEITQSDIQKWGGMHVVEFSSIWGETNPRIVTTDA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttaataaaactacactggcaattcttctgggactgagtctgtaccaaggtgct
gctcaagctgcgcctgtactttcttcagacaatactcaggcaaaacgtgttgctgctcat
aacaatgcctgggttgaaatcaataccaccactttcgaaaacaatatccacatattgcaa
caaaaactaaatagaaacaccaaaatgtgtgcagtcctgaaaggtgacgcctatggtcat
ggtatcggtctgctgatgccatctgtcattaagactggcgtactctgtgtcggcattacc
agcaatgaagaagcacgcatcgtgcgtgaaagcggttttaaagggcaattgattcggatc
cgtacagctgatgtgtctgaaatagaaagtacactgggctatgacatggaagaaataatt
ggcgatctggcacatgctaagacagttgctgatctggcaaaaaaacacggtaaagaaatc
cgtgtccatctggcactgaacaccggtctgatgagccgcaatgggctggaaatgaaaact
gaacagggtaaacaagaagcgctgaaaatgactcagttgcctaatctgaaactggtcggg
atcatgagccatcacgcactcaccgatttggacgcaatccgtgacagcatcaaaaacttt
aatgagcaaacagcgtggttgatcaaagcggcaaacctgaaaagagatgaaatcaccctg
cacgcttcaagttcttttgcatcagtcagcattcctgaagcacaattcgatatggtacgt
gtaggtagcgcgctgtacggcatcctgaccaacacccacccagaattcaagccgttgatt
caggtaaaaacccacgttgcttctgttaaatcctaccctaaaggtaatggtgtcagctac
aataatacctacattctgaaacgcgattctaaactggctaacctgccagtcggtttctct
gatggcttcagctcctccctgtcaaacaaagcttatgtcctgatcaacggtcaccgcgca
cctgttgttggcagtgtttccatgaataccgtgatggccgatgtgactgatctgccagaa
gtgaaaagtggtgatgaagttgttatcttcggtaaacaaggcaacgaagaaatcacccag
tctgacattcagaaatggggcggaatgcacgttgttgaattctcttctatttggggagaa
accaacccccgtatcgtgaccacagatgcgtaa

DBGET integrated database retrieval system