KEGG   Xenorhabdus nematophila AN6/1: XNC2_4319Help
Entry
XNC2_4319         CDS       T03752                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm00564  Glycerophospholipid metabolism
xnm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xnm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XNC2_4319 (glpD)
Enzymes [BR:xnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XNC2_4319 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 FAD_oxidored 3HCDH_N HI0933_like Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: CEK25306
UniProt: A0A0R4D003
LinkDB All DBs
Position
I:complement(4278009..4279514)
Genome map
AA seq 501 aa AA seqDB search
METKDLIIIGGGINGAGIAADAAGRGLSVLLLEGQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDNLGKRVSLPGS
KGLKFGAHSVLKPSITRGFEYSDCWVDDARLVVLNAQEVQKHGGEVRTRTQVTRAYREND
YWVVEAEDLTTGETHTWRAKGLVNATGPWVKNFFDNGLQLKSPYGIRLIKGSHIVVPRVH
DEPQSYILQNEDNRIVFVIPWNNDFSIIGTTDVEYQGDPKDVKIDDKEIDYLLKVYNDHF
KKQLSRDDVVWTYSGVRPLCDDESDSPQAITRDYTLDVQDEQGQTPLLSVFGGKLTTYRK
LAEHAMEKLAQYYPNAGKAWTKTGQLPGGDLDGYDRDGYARLLRQRYNWLPEGMALRYAR
TYGSHSQIILKGAEALTDLGEFFGHGLYEAELRYLVEHEWVRQLDDAIWRRTKLGMWLTD
EQKQRVADWLAQNVKSAQPQG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgattatcatcggcggcggaattaacggcgctggtattgcagca
gatgctgctggccggggactttccgtcctgctgttggaaggtcaagacttggccagcgcg
acttcgtctgccagttcaaagctgatccacggtggcttacgctatctggaacattatgaa
ttccgtctggtcagtgaagcactggcagaacgtgaagtactcttgaaactggctccccat
attgcattcccgatgcgttttcgtttgccacaccaaccgcatctgcgtcctgcctggatg
atccgcattggtctgttcctgtacgataacttgggtaaacgtgttagcttaccgggcagc
aaggggctgaaattcggtgcacactcagtactgaaaccctccatcacccgtggctttgaa
tattccgactgttgggttgatgatgcacgtctggttgtgctgaacgcgcaggaagtacaa
aaacacggtggcgaagtgcgtacccgtacccaagtcacccgagcatatcgtgaaaatgat
tactgggtagttgaggctgaagatctcaccacaggggaaacccacacatggcgcgcgaaa
ggcctggtcaacgcgaccggaccgtgggtgaaaaacttcttcgataacggactgcaattg
aaatcaccttatggtatccgtttgatcaaaggcagccatatcgttgttccccgcgtccat
gatgagccgcagtcttatattctgcaaaacgaagataaccgcatcgtatttgtcattcca
tggaataatgatttttccatcatcggtacgactgatgttgaataccaaggcgatccgaaa
gacgttaaaattgatgataaagaaatcgattatttgttgaaagtctataacgatcacttc
aaaaaacaacttagccgcgatgatgttgtctggacttactctggcgttcgcccgttatgt
gatgatgaatccgattcaccacaagcgataacccgcgattacacactggatgtacaagat
gaacagggacaaacgccattattgtcggtattcggtggcaagctgacgacttaccgtaag
ctggctgagcatgctatggagaaactggcacagtactatccaaatgctggcaaggcatgg
accaaaaccggccagttaccgggcggtgatctggacggttatgaccgcgatggttatgcc
cgcctgctgcgtcagcgctataactggttaccagaaggtatggcactgcgttatgcccgc
acttacggcagccacagccaaatcatcctgaaaggagctgaagccctgaccgatctcggc
gagttctttggtcatggcctgtatgaagctgaactacgttatctggttgaacacgagtgg
gtcagacaattggatgatgctatctggcgccgcactaaactgggtatgtggctcactgat
gagcagaaacagcgcgtcgctgactggctggcacagaacgtcaaatcggctcaaccacag
ggctga

DBGET integrated database retrieval system