KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO0324Help
Entry
XOO0324           CDS       T00360                                 

Gene name
XOO0324
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00473  D-Alanine metabolism
xom00550  Peptidoglycan biosynthesis
xom01100  Metabolic pathways
xom01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    XOO0324 (XOO0324)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XOO0324 (XOO0324)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    XOO0324 (XOO0324)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xom01011]
    XOO0324 (XOO0324)
Enzymes [BR:xom01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     XOO0324 (XOO0324)
Peptidoglycan biosynthesis and degradation proteins [BR:xom01011]
 Precursor biosynthesis
  Amino acid ligase
   XOO0324 (XOO0324)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAE67079
LinkDB All DBs
Structure
PDB: 

Position
355636..356739
Genome map
AA seq 367 aa AA seqDB search
MRKIRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKQGQWHVNDPDSFLLH
ADDPARIALHRSGRGVALLPGAQQQQLRPIQPEQALAQIDVVFPIVHGTLGEDGSLQGLL
RMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAAHADVDTLIAQLGL
PLFVKPANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVAGREIECAVLGNAVPH
ASVCGEVVVHDAFYSYATKYISEHGAEIVIPADIDAQTQQRIQQIAVQAYQALGCAGMAR
VDVFLCADGRIVINEVNTLPGFTRISMYPKLWQASGLDYRGLITRLIELALERHTDDQLL
RSAVELH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagatccgggtcggcctcatcttcggcggcaaatcggccgagcacgaggtttcg
ttgcaatcggcgcgcaacatcctggatgcgctggacccgcaacgcttcgagccggtgctg
attggtatcgacaagcaaggccaatggcacgtcaacgaccccgacagcttcctgctccat
gccgacgacccggcacgtattgcgctgcatcgcagtggtcgcggggtggcactgctgccg
ggcgcgcaacagcagcaattgcggcccatccagccggagcaggcgctggcgcaaatcgat
gtggtgttccccatcgtgcacggcaccttgggcgaagacggctcgctgcaggggctgctg
cgcatggccaacctgcccttcgtgggctccggcgtgctgggctcggcggtggcgatggac
aaggacatggccaagcgcgtgttgcgcgatgccaggctggcggtggcaccgttcgtctgc
ttcgaccgccacaccgccgcgcacgccgatgtggatacgttgatcgcgcagctgggcttg
ccgttgttcgtcaaaccggccaaccagggctcatcggtcggcgtcagccaggtgcgcacg
gccgacgcattcgctgctgcactcgccttggcgttggcctatgaccataaggtgctggtg
gaagcggccgttgccgggcgcgaaatcgaatgcgccgtgctgggcaatgccgtgccacac
gcaagcgtctgcggcgaagtggtggtgcacgacgcattctattcgtacgcaaccaaatac
atcagcgaacacggtgccgagatcgtgattccggccgacatcgatgcgcagacccagcaa
cgcatccagcagatcgcagtgcaggcctaccaggcgctgggctgcgcaggcatggcgcgc
gtggacgtctttttgtgcgccgatgggcgcatcgtgatcaacgaggtcaacacgctgcca
ggcttcacccgcatcagcatgtatccgaaattatggcaggcaagcgggctggactatcgc
ggtctgattacgcggttgatcgagctcgcactggaacggcacacagacgaccaactgctg
cgcagcgcggtcgagctacactga

DBGET integrated database retrieval system