KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO2305Help
Entry
XOO2305           CDS       T00360                                 

Gene name
XOO2305
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00380  Tryptophan metabolism
xom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XOO2305 (XOO2305)
Enzymes [BR:xom01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     XOO2305 (XOO2305)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAE69060
UniProt: Q2P317
LinkDB All DBs
Position
2565337..2566608
Genome map
AA seq 423 aa AA seqDB search
MTDLLSRAHADALDAADPLRSLRDAFVFPQHGDRDQTYLVGNSLGLQPRAARAMVDEVLD
QWGTLGVEGHFTGPTQWLTYHQLVRDALARVVGAQPGEVVAMNTLSVNLHLMMASFYRPT
HERGAILIEAGAFPSDRHAVESQLRLRGLDPATHLIEVEADEPNGTLSMAAIADAIAQHG
PRLALVLWPGIQYRTGQAFDLAEIVRLARAQGAAVGCDLAHAVGNIPLTLHDDGVDFAVW
CNYKYLNAGPGAVGGCFVHERHANSDLPRIAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLALFDQTGMAALRAKSERLTGHLEQLIHARVPQVLQIVTPAEPMRRG
CQLSLRVAGGRAQGCSLFEHLHAAGVLGDWREPDLIRIAPVPLYNRFSDLHTFVGQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgctgtcccgcgcccatgccgatgccctggatgccgccgacccgctgcgc
agcctgcgcgatgccttcgtgttcccgcagcacggcgatcgggatcagacgtatctcgtc
ggcaactcccttggcctgcagccgcgcgcggcgcgcgcaatggtggacgaagtgctcgat
cagtggggcacgttgggggtggaaggtcacttcaccggccccacccaatggctgacctat
caccagctggtacgcgatgcgctggcccgcgtggtcggcgcgcaacccggcgaggtggtg
gcgatgaacaccctcagcgtcaatctgcacctgatgatggcgagcttttatcgtcccacg
cacgaacgcggcgcgatcctgatcgaagccggcgcgtttccgtccgaccgtcacgcggtg
gaatcgcagctgcgcctgcgcgggctggacccggccacgcatctgatcgaagtggaggcc
gacgaacccaacggcacgttatcgatggccgccattgccgatgccatcgcgcagcatggt
ccgcgcctggcgttggtgctgtggccgggcatccagtaccgcaccgggcaggccttcgac
ctggccgagatcgtgcgactggcgcgggcgcaaggcgcggcggtgggctgcgatctggcg
catgcggtgggcaacatcccgctgaccctgcacgacgatggcgtggatttcgcagtgtgg
tgcaactacaaatatctcaacgccggccccggcgcggtgggcggttgcttcgtgcacgaa
cgtcatgccaacagcgatctgccgcgtatcgccggctggtggggacatgagcagcagacc
cgcttccgcatggacccgcagttcgtgccctcgcccggcgccgaaggctggcagctgagc
aatccaccggtgctggcgctggcgccgctgcgcgcatcgctggcgttgttcgaccagacc
ggcatggccgcgctacgcgccaaatccgaacgactcaccgggcatctggagcagttgatc
cacgcgcgcgtgccgcaggtgctgcagatcgtcaccccggccgaaccgatgcgccgcggc
tgccagctgtcgttgcgggtggccggcggacgcgcgcaggggtgctcgctgttcgagcat
ctgcatgcagccggcgtgctcggcgactggcgcgaaccggacctgatccgcattgcgccg
gtgccgctgtacaaccgcttcagcgatctgcacaccttcgtgggccaggtggaagcctgg
gcggctgcctga

DBGET integrated database retrieval system