KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3448Help
Entry
XOO3448           CDS       T00360                                 

Gene name
XOO3448
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Brite
KEGG Orthology (KO) [BR:xom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XOO3448 (XOO3448)
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XOO3448 (XOO3448)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase Thi4 Thioredoxin_4 AlaDh_PNT_C NAD_binding_8 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: BAE70203
LinkDB All DBs
Position
3905005..3906597
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQ
RKPSFALTTPGQDIALRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNASKRDAAKIAAKGAFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYEVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADDVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGAIQHFDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPATADNVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcaaatcaacgcatcgatcgacgaaagccctggttcgcgcgaaatgctcgacctgctg
gaagagttggtgctgttgtcggacaagatcagcctggacatccaccgcgacgacgaccag
cgcaagccctcgttcgcgctgaccacgccgggccaggacatcgcgctgcgtttcgccggg
ctgccgatgggccatgaattcacctcgctggtgctggcgctgctgcaggtgggcggccac
ccgtccaaggcggctgccgaactgatcgagcaggtgcagcacctggatggcgattaccgg
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
cttgccgccgtgctcaacccgcgcatcaagcacgtggccatcgacggtgcgtggttccag
gacgaagtggaaacccgccagatcatgtcagtgcccaccgtgtatttgaacggcgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgcgtcc
aagcgcgacgctgcgaaaatcgccgcgaaaggggcgttcgacgtgctggtggtgggcggt
ggcccggccggtgcggcagcagcggtgtatgccgcgcgcaagggcatccgcaccggcgtg
gcggccgagcgtttcggtggccaggtgctggacaccatgtcgatcgaaaacttcatctcc
gtgccggaaaccgaaggcccgaagatggccgccgcgcttgagcagcacgtgcgtcagtac
gaggtggacatcatgaacctgcagcgcgccgagcaactgattccagccggtgccgatggc
ctgatcgaaatcaaactcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcccggcgaagaccagtacaagaacaagggt
gttgcgtattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcagtgatc
ggcggcggcaactccggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctagtggaattcgacgacaagctgcgcgccgatgacgtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctcggcgacggg
cagaaggtgaccggcctggtctacaaggaccgcaccggtggcgctatccagcacttcgat
ctggaaggcgtattcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtagcgctgtcgccgcgcggcgagatcatcgtcgacgaccgcggccagaccgatgtgccg
ggcgttttcgccgccggcgacgctaccacggtgccctacaagcagatcgtgatcgcgatg
ggcgaagggtccaaggcggccctgagcgcattcgatcatctgatccgctccagcgcaccg
gccactgccgataacgtggcccaggccgcataa

DBGET integrated database retrieval system