KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3521Help
Entry
XOO3521           CDS       T00360                                 

Gene name
XOO3521
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00010  Glycolysis / Gluconeogenesis
xom00053  Ascorbate and aldarate metabolism
xom00071  Fatty acid degradation
xom00280  Valine, leucine and isoleucine degradation
xom00310  Lysine degradation
xom00330  Arginine and proline metabolism
xom00340  Histidine metabolism
xom00380  Tryptophan metabolism
xom00410  beta-Alanine metabolism
xom00561  Glycerolipid metabolism
xom00620  Pyruvate metabolism
xom00625  Chloroalkane and chloroalkene degradation
xom00903  Limonene and pinene degradation
xom01100  Metabolic pathways
xom01110  Biosynthesis of secondary metabolites
xom01120  Microbial metabolism in diverse environments
xom01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO3521 (XOO3521)
   00053 Ascorbate and aldarate metabolism
    XOO3521 (XOO3521)
   00620 Pyruvate metabolism
    XOO3521 (XOO3521)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XOO3521 (XOO3521)
   00561 Glycerolipid metabolism
    XOO3521 (XOO3521)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO3521 (XOO3521)
   00310 Lysine degradation
    XOO3521 (XOO3521)
   00330 Arginine and proline metabolism
    XOO3521 (XOO3521)
   00340 Histidine metabolism
    XOO3521 (XOO3521)
   00380 Tryptophan metabolism
    XOO3521 (XOO3521)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOO3521 (XOO3521)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOO3521 (XOO3521)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOO3521 (XOO3521)
Enzymes [BR:xom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XOO3521 (XOO3521)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAE70276
LinkDB All DBs
Position
3981813..3983282
Genome map
AA seq 489 aa AA seqDB search
MEAVSETLRGIAARGPLGLFIDGQWRASTGDRHVDVIAQHTQESLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSMLLKRVAEQLRARMPELAEAWTGQVDATIGFSKRASQQA
PNLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWKAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARVGLKLGGKSAAIVLEDADSAKVLPTLVPYSMPIAGQVCFSLT
RMLVPAQRRDEILQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVRSYIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEFTPDMTIARGEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMRVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtatccgaaacgctgcgcgggatcgccgcgcgtggtcctctgggcttgttc
atcgatggacaatggcgcgcaagcacgggagatcgccatgtcgatgtgatcgcgcagcat
acccaagaatcgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcatgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcgacgccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccgaatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaaggcgccgctggtcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggt
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcgggtcggc
ctgaaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacagcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcatgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtttgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcctatattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaattcacaccggacatgaccattgcgcgcggggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcatcgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgcgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system