KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO3578Help
Entry
XOO3578           CDS       T00360                                 

Gene name
XOO3578
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00620  Pyruvate metabolism
xom00680  Methane metabolism
xom01100  Metabolic pathways
xom01120  Microbial metabolism in diverse environments
xom01200  Carbon metabolism
Module
xom_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOO3578 (XOO3578)
  09102 Energy metabolism
   00680 Methane metabolism
    XOO3578 (XOO3578)
Enzymes [BR:xom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XOO3578 (XOO3578)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAE70333
UniProt: Q2NZE4
LinkDB All DBs
Position
complement(4045283..4047997)
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLTGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERTSDAARFRMALTASWQTADSSPVRPTVGDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDANTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSPELMTQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYTAPSELEDDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATRRAAVLGPYACGQEALPRVQDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDAAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAADLGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVAAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDSLREMA
QDWPFFRTFLDDVAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGL
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctgctcgccgagcaggtgtctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgccccg
ccctccacgttgagcgaacaactcaccgggcgcgagccgcgtgatgccgaagcgctggtg
cgcgccttcagtacctatttccaggtcgtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgccgcgagtaccagcgcagcgggaccgacacgccgcagccggatggcctgcacgac
gcattgcgtcggctcaaggcgcagggcgtgacgctggacgaactcagccagtggttgccg
cgcatcgatgtggagccggtgttcaccgcgcatcccaccgaggcggtgcgccgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaatgagcgcaccagcgatgcggcacgtttccgcatggcgttgaccgcatcgtggcag
accgccgattcctcgccggtgcgccccaccgtgggcgacgagcgcgagcatgtgggcttc
tatctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaaccctcgaacacgcc
atcgaagaaacctatggcagcgtgccagccctgccgcgcctgctgcgtttcggcacctgg
gtgggcggcgacatggacggcaatcccaatgtggatgccaacaccatcgccggcaccctg
gatgcacaacggcgcgcggtgctggaccgctatcaaaaggaactctggcagctggccagc
ctgctcagtcaatcgaccacgctggtgcaggtgagcccggaactcatgacgcagctggaa
cgctatcgcgcgctgctgcccgacgccgcggcacggtcgcgtccacgtcacggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcccgcctgcaggccacactggacgacgcc
gacggcgcctataccgccccttctgaactcgaagacgatctgcagttgatcctggacagc
ctgcaggccaacaagggcctgcacgccggttggttcgccgtgcggcgtctgctgtggcgt
gtgcgcagtttcggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcggtggccgatgccttgggccagaccgactgggacgcgcaggacgcaacccgg
cgcgccgccgtgctcggcccgtatgcctgcgggcaagaagccttgccgcgcgtgcaggat
gaaggcaatgcgcggctggacgcggtattcgccgcgctcgccgatgcacgcacgcgccac
ggtgccgatgcactgggcagctacatcatttcgatggcgcacaaccgcgccgacgtgctc
actgtgctggcgctggcgcgccgcggcggattggtcgacgccgccggcgccgtgccgcta
gatatcgtgccgctgttcgaaaccgtggacgacctgcgcggcggcaccggcacggtgcag
gacctgctggccgacccggtatatcgccagcatctggccgcgcgcggcgatacgcagatg
gtgatgttggggtattcggatagcggcaaggacggcggcatcgccgcctcgcgctggggg
ctgcagcgtgcgcaggtggaactgctggaagccgctgccgatctgggcgtgcggctgacc
ttcttccacggccgtggcggttcgatcgcgcgcggtggcggcaagaccagccgcgcgctg
gacgccgccccgcgcggcagcgtcgatggccgcctgcgcgtcaccgagcagggcgaggtg
atccaccgcaagtacggcatccgtgcattggccttgcgctcgctggagcagatgaccggc
gcggtgttgctttcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgctggcgc
ccggtgatggatctggtggccgaacgcagcaccgtcgcgtatcgcgccttcgtcgccgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggctcgcggccctcgcggcggctggggcaggacgcggcgttgtccaacctgcgtgcg
attccgtgggtgttcgcctggagccaggcacgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagacagcctgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgatgtcgccatggtgctgtccaagggc
gatctgaatatcgccgagttgttttcgcgcttgtccggcgacttgcacacgcggtttttc
ccgctgattcgcgacgaactggccttgaccaagggctgggtcaaggcactgctgcagcag
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaacccgtac
atcgacccgatcagcgtgctgcaggtagacctgctgcagcgctggcgcgctaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaacggcgtctcgcaaggtttg
cagaacactggttga

DBGET integrated database retrieval system