KEGG   Xanthomonas oryzae pv. oryzae MAFF 311018: XOO4039Help
Entry
XOO4039           CDS       T00360                                 

Gene name
XOO4039
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
xom  Xanthomonas oryzae pv. oryzae MAFF 311018
Pathway
xom00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xom01100  Metabolic pathways
xom01110  Biosynthesis of secondary metabolites
xom01130  Biosynthesis of antibiotics
xom01230  Biosynthesis of amino acids
xom02024  Quorum sensing
Module
xom_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:xom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XOO4039 (XOO4039)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XOO4039 (XOO4039)
Enzymes [BR:xom01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     XOO4039 (XOO4039)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: BAE70794
LinkDB All DBs
Position
complement(4554038..4555111)
Genome map
AA seq 357 aa AA seqDB search
MPPVTDDLRIRKIEALAPPSQLLSLLPCDERASETVTNARAALHKILHGRDDRLAVVIGP
CSIHDPVAAMEYAQRLRPLRDQFGDALEIVMRVYFEKPRTTIGWKGLINDPDLDGSFQIN
KGLRVARGLLRDINNLGLPAGVEFLDIISPQYIADLVAWGAIGARTTESQVHREMASGLS
CPVGFKNGTSGDVKIAVDAVGAASHPHHFLAVTKDGHTAVAATAGNPDCHVILRGGKQPN
FDAANVEAASQVLNKSGLPARLMIDASHANSSKNPENQPKVIDDISNQLEAGETRIVGVM
VESHLVGGRQELLPGCALTYGQSITDGCIGWDTSVQVLERLATAVRARRARRIAEAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgtgaccgatgacctgcgtatccgcaagatcgaagccctcgcaccgccttcg
cagctgctgtcgctgctgccctgcgatgagcgcgcctccgaaaccgtgaccaacgcgcgc
gctgcgctgcacaagatcctgcacgggcgcgacgaccgcctggcggtggtgatcgggccc
tgctcgatccacgacccggtggcggcgatggagtacgcgcagcgcctgcgcccattgcgt
gaccaattcggcgacgcgctggagatcgtgatgcgggtgtacttcgaaaagccgcgcacc
accatcggctggaagggcctgatcaacgacccggatctggatggcagcttccagatcaac
aaaggcctacgcgtagcgcgcggcttgctgcgcgacatcaacaatctcggcttgccggcc
ggcgtggaatttctcgacatcatttcgccgcaatacatcgccgatctggtggcctggggc
gcgatcggtgcccgcaccaccgagagccaggtgcatcgcgaaatggcgtccggcctgtcg
tgcccggtgggcttcaagaacggcaccagcggcgacgtcaagattgcggtggacgcggta
ggcgcggcctcgcatccgcatcatttcctggccgtgaccaaggacggacataccgccgtg
gcagccacggcaggcaatccggattgccacgtgattctgcgcggcggcaagcagcccaac
ttcgatgcagccaatgtggaagcggccagccaggtgctcaacaagtcgggcttgccggcg
cgcctgatgatcgatgccagccacgccaacagcagcaagaaccccgagaaccagcccaag
gtcatcgacgacatcagcaatcagctggaagcaggcgaaacgcgcatcgttggcgtgatg
gtggaaagtcaccttgtcggagggcgccaggaattgctgccgggttgcgcgctgacctac
gggcagagcatcaccgatggctgcatcggttgggatacgtcggtgcaggtgctggaacgt
ctggcgacagcagtgcgcgcgcggcgtgcgcgacggattgccgaggctgcgtga

DBGET integrated database retrieval system