KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO0008Help
Entry
XOO0008           CDS       T00235                                 

Gene name
tonB
Definition
(GenBank) TonB protein
  KO
K03832  periplasmic protein TonB
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xoo02000]
    XOO0008 (tonB)
Transporters [BR:xoo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   XOO0008 (tonB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_C TonB_2
Motif
Other DBs
NCBI-ProteinID: AAW73262
UniProt: Q5H708
LinkDB All DBs
Position
11190..11861
Genome map
AA seq 223 aa AA seqDB search
MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPAVAPKAPAEKERTTMV
TLVDAPPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPPPEAPVVDVPEPRPSDIVTPP
SPPTPPAQPSDIGASVDISSKNMNPPKYPPAAFRAGVQGEVILIVDVDANGNVTNVSVEK
SSRNRDLDRAAMDAARKWKFNASTVNGQKAAGRARVPVNFALN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaactcgttatccacaggcatgactacgatgccgggaaccagggtctgagc
tgggcccgcattatcggcattgcttttgtaattgctttgcacctcactgcactgatgatg
ttgctgatccctgcagtggcgccgaaggctccggcagagaaggagcgcaccaccatggtt
accttggtggatgcaccgcctcctcccccgccgccgccgccgccgccgcccccggaagac
aagccgccgccgccggtcaagaatctgtcgccgccgaagccgtcaccggttccgccgccg
ccggaagctccggtggtcgacgttcccgaaccgcgtccgagcgatatcgtcacgccgccg
agcccgccgacccccccggctcagcccagcgacattggcgccagcgtcgatatctcgtcc
aagaacatgaacccgccgaaatacccgccggcagccttccgtgccggtgtccaaggtgag
gtcatcctgatcgtggatgtggacgccaacggcaacgtgaccaatgtgtcggtcgaaaag
tccagccgcaaccgcgaccttgaccgtgctgcgatggacgcagcacgcaagtggaagttc
aacgcctccactgtcaacgggcagaaagctgccggacgtgcccgcgtcccggtcaacttt
gctctgaactga

DBGET integrated database retrieval system