KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1450
Entry
XOO1450           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345 Phage_base_V
Other DBs
NCBI-ProteinID: AAW74704
UniProt: Q5H2W7
LinkDB
Position
1480248..1483232
AA seq 994 aa
MHATGTDGARPLRRGLPRACMRACMRAAASSVKFALQGQETMLPGARWPEDRGIVMEALN
ALMFQGALLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWL
GRRATLYTRLADGDESPRTGLIHDAYALGSDGGLARYRVGLVPWTWWLSQGRHSRVFQER
TLVQIVEAVFADYAPMASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGW
RLQEADASPGGHQLVVFADSVAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGS
GRLTVLSEDFKTRQARSAQLPLHGGGRQSLREVYEPVGMDAFASAQAADRSAELMAQAHE
AQWSPWQGRSTVRTLRAGTWFTLTQAPQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQS
QLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHPRPTAP
GYQSAIVVGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGV
GSQFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAKAGD
GRPSAQGNLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRL
QLATTQAATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPA
GEATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSV
KTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETL
TLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGRQTQANSLSLVSGEGALDVQAQSDDVR
VQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACPGTITVQASKKSFVG
PVNLGYGLPLFPESVCVECMLKAAANGSPFAALQ
NT seq 2985 nt   +upstreamnt  +downstreamnt
ttgcatgccactggcaccgacggcgcccgaccgctgcggcgcggcctgccgcgcgcctgc
atgcgcgcctgcatgcgcgccgccgcctcgtctgttaaattcgccctccaggggcaggaa
acgatgttgcccggggcgcgatggcccgaggacagaggtattgtgatggaagcactgaat
gcgttgatgtttcagggggccttgctgtccgacagcggccgcctataccgcttgcagctg
cctggcggggatgtccaggtggtggagcgctggagcgggtcggaacggctgagcggcggt
tttgagtggtgggtggacgtgctgagcacgcaggcgggcttgccgctggaggcgtggctg
gggcggcgcgcgacgctgtacacccggctggccgatggcgatgaaagcccgcgcacgggg
ctgatccacgacgcgtacgcactgggcagcgacggcgggctggcgcgctaccgggtaggc
ctggtgccgtggacgtggtggttgtcgcagggccggcacagccgggtattccaggaacgc
acgctggtgcagatcgtggaagcggtgttcgccgactacgcgccgatggcaagctggcag
tggagcgaggagacgagcgcgttcctggcccaggcgcggccgcgcagctactgcgtgcag
taccgcgagagcgacctggatttcgtgcagcggctgctggccgaggaaggcctgggctgg
cggctgcaggaggcggacgcgtcgcccggcgggcaccagctggtggtgttcgccgacagc
gtcgcgcaaccgcaggaccccagttcggcgcagggcggcgggctgcgctaccaccgcagc
gacgccaccgaggcggccgacagcgtgctggcgatcggcgccacccggcggctgggcagc
ggccggctgacggtgctcagcgaggacttcaagacgcgccaggcgcgcagcgcgcagttg
ccgttgcacggcggcggcaggcagtcgctgcgcgaggtgtacgagccggtggggatggac
gccttcgccagcgcgcaggcagcagaccgctctgcggagttgatggcgcaagcgcacgag
gcgcagtggtcgccgtggcagggccgcagcacggtgcgcacgctgcgcgccggcacctgg
ttcacgctgacccaggcaccgcagcagggccaggcaccgccggcgcagctgttgctgacg
cgggtgtggcatgcgggtatcaacaacttgccggtggacgtgcgcgcggcggtgcagtcg
cagttgggggccgcgccggcgtggccggatgccagcgcggtggccgcacgcagcacctgg
gcgcaggccgaggcggtgggctacggcaacgccttcgaggcggtggaccggcagcagccg
tggcggccggtgctggccgacggcaccggggcgcggctgcacccgcggccgaccgcgccg
ggctaccagagcgccatcgtggtcggtgccgatggcagcaccgacggcagccaggaggtc
catgccgacgcgctgggccggatccgggtcaggttccacttccagcacgccgcgtcggcc
ccggcggcgcaggacagcacgtggctgcgggtggcgcagcgctacgccggcccgggcgtg
ggcagccagttcctgccacgcatcggccaggaagtgctggtgggcttcctggagggggac
atcgaccgtccggtggtgctgggggcgctgtacaacggcaagggcgaagccggcgttccc
gccacccccggcggcaccagcgccgaggccgacaccggcctgtacgccaaggccggcgac
ggcagacccagcgcgcagggcaacctggccggcggccatgccccggcctggcacggcgcc
ggcggcggcgcggacaaccaccgcaacgccaccgcgctgtggggcgtgcaatccaaggaa
tggggcggcgctggccacagccggctggtgttcgacgacagcgaccagcaactgcgcttg
cagctggccacgacccaggcagccacgcaactgaacctggggcacctgatccaccaggcc
gacaactaccgcggcagcttccgcggggaaggcttcgaactgcgcaccgacgcgtggggc
gcggtgcgggccagctcggggctatggctgagcagctacggccgcagcggcggcccggcc
ggcgaggcgacccagcccagcgcattgctgagccagctgcagacgctgggcaagacgttc
tcgcaggcggcgggcacgcaccagacggtgaagctggccgcgcacgaaggcgtgggccag
gcgaaccactcccagctgatcgccgagcaggcaccgctgccggcgctgctgaccagcgtg
aagaccacggtgccgggcacggcctacgccgacgccaagggtgcggcggccgagcgccgc
gccagcccgggcgacgaccgggtgccgcataccggcgatgcgctgctgggcctggccgca
ccagcggggatcggcgtggtggccggccagggcctgagctggagcgtgggcgagacgctg
acgctggccagcggcgcgggcagcgaagcggccatcgccggcgacgcccggctgcacagc
ggccaggcaatcggcgtgctggccgcggcggtggacggccggcaaacgcaagccaacagc
ctgagcctcgtcagcggcgaaggcgcgctggacgtgcaggcgcagtcggacgacgtgcgc
gtgcagtcgaaagaaggcctgaagctgatcagcgccaacgccgacgtggccctggcggcg
ggcaagaccctccacctggcggtggccggcggggccagcgtgaccatcgaaggcggcaac
atcaccgtcgcctgccccggcaccatcaccgtgcaggcgagcaagaagtcgttcgtgggg
ccggtcaacttgggatatggcctaccgctattccccgaatctgtgtgcgtcgaatgcatg
ctcaaggcggcggctaacggctccccgtttgcggcactgcaatga

DBGET integrated database retrieval system