KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO1453
Entry
XOO1453           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) VGR-related protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: T6SS_Vgr DUF2345 Phage_base_V
Other DBs
NCBI-ProteinID: AAW74707
UniProt: Q5H2W4
LinkDB
Position
1488850..1490751
AA seq 633 aa
MRSFTDTRTARRTLARSIGLLTQSPQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQSQL
GAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHPRPTAPGS
QSAIVVGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGS
QFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGSSAEADTGLYAQAGDGR
PSAQGNLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQL
ATTQAATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGE
ATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSVKT
TVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETLTL
ASGAGSEAAIAGDARLHSGQAIGVLAAAVDGRQTQANSLSLVSGEGALDVQAQSDDVRVQ
SKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACPGTITVHASKKSFVGPT
TLNRSFVAWPQSNLNAPCMMQAAATNSAFVRVD
NT seq 1902 nt   +upstreamnt  +downstreamnt
ttgcgatcatttaccgacacacgcaccgccaggcgcacgttggcccgctccatcgggctg
ctgacccagtcaccgcagcagggccaggcgccgccggcgcagctgttgctgacgcgggtg
tggcatgcgggtatcaacaacttgccggtggacgtgcgcgcggcggtgcagtcgcagttg
ggggccgcgccggcgtggccggacgccagcgcggtggccgcacgcagcacctgggcgcag
gccgaggcggtgggctacggcaacgccttcgaggcggtggaccggcagcagccgtggcgg
ccggtgctggccgacggcaccggggcgcggctgcacccgcggccgaccgcgccgggctcc
cagagcgccatcgtggtcggtgccgatggcagcaccgacggcagccaggaggtccatgcc
gacgcgctgggccggatccgcgtcaggttccacttccagcacgccgcgtcggccccggcc
gcgcaggacagcacgtggctgcgggtggcgcagcgctacgccggcccgggcgtgggcagc
cagttcctgccacgcatcggccaggaagtgctggtgggcttcctggagggggacatcgac
cgtccggtggtgctgggggcgctgtacaacggcaagggcgaagccggcgttcccgccacc
cccggcggcagcagcgccgaggccgacaccggcctgtacgcccaggccggcgacggcaga
cccagcgcgcagggcaacctggccggcggccatgccccggcctggcacggtgccggcggc
ggcgcggacaaccaccgcaacgccaccgcgctgtggggcgtgcaatccaaggaatggggc
ggcgctggccacagccggctggtgttcgacgacagcgaccagcaactgcgcttgcagctg
gccacgacccaggcagccacgcaactgaacctggggcacctgatccaccaggccgacaac
taccgcggcagcttccgcggggaaggcttcgaactgcgcaccgacgcgtggggcgcggtg
cgggccagctcggggctatggctgagcagctacggccgcagcggcggcccggccggcgag
gcgacccagcccagcgcattgctgagccagctgcagacgctgggcaagacgttctcgcag
gcggcgggcacgcaccagacggtgaagctggccgcgcacgaaggcgtgggccaggcgaac
cactcccagctgatcgccgagcaggcaccgctgccggcgctgctgaccagcgtgaagacc
acggtgccgggcacggcctacgccgacgccaagggtgcggcggccgagcgccgcgccagc
ccgggcgacgaccgggtgccgcataccggcgatgcgctgctgggcctggccgcaccagcg
gggatcggcgtggtggccggccagggcctgagctggagcgtgggcgagacgctgacgctg
gccagcggcgcgggcagcgaagcggccatcgccggcgacgcccggctgcacagcggccag
gcaatcggcgtgctggccgcggcggtggacggccggcaaacgcaagccaacagcctgagc
ctcgtcagcggcgaaggcgcgctggacgtgcaggcgcagtcggacgacgtgcgcgtacag
tcgaaagaaggcctgaagctgatcagcgccaacgccgacgtggccctggcggcgggcaag
accctccacctggcggtggccggcggggccagcgtgaccatcgaaggcggcaacatcacc
gtcgcctgccccggcaccatcaccgtgcatgcgagcaagaagtcgttcgtggggccaacg
acgctgaaccggtcgtttgtcgcttggccgcaaagcaacttgaatgcgccttgcatgatg
caggctgcggcgaccaatagcgcgtttgtgcgagtggactaa

DBGET integrated database retrieval system