KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2335Help
Entry
XOO2335           CDS       T00235                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XOO2335 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xoo02000]
    XOO2335 (gst)
Enzymes [BR:xoo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XOO2335 (gst)
Transporters [BR:xoo02000]
 Other Transporters
  Pores ion channels [TC:1]
   XOO2335 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_2 GST_C_3 GST_C DBI_PRT GST_C_5
Motif
Other DBs
NCBI-ProteinID: AAW75589
UniProt: Q5H0D2
LinkDB All DBs
Position
complement(2473230..2473814)
Genome map
AA seq 194 aa AA seqDB search
MAADRTGCPARVATAGFRTRRAHIVAVSGDQSRRRGTPLVLDGHVLTEAAATALQLADLH
PQATLAPAPGTPERAAYYTWMFFCANTLQPASRAWFYPSEPAGAEHAEAAQVQARRKLEA
AWTQVAAHLQVHGPYLLGHTLSAADFMLTMLMRWSRNMPRPTDTWPALQAHATLMKARPA
FQETYRREGLTDWT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttggctgctgatcgaactggatgtcccgcacgagttgcaaccgctggatttcgaacgcgg
cgagcacacatcgtcgcagtatctggtgatcaatcccgccggcgtggtaccccgctggta
ctggatgggcacgtgctcaccgaggctgcggccaccgcgctgcagctggccgatctgcat
ccacaggcgacgctggcacccgcgcccggcacacccgaacgcgcggcgtactacacgtgg
atgttcttctgcgccaataccttgcagccggcatcccgcgcctggttctatccgagcgaa
ccggctggtgccgagcatgccgaggctgcacaggtgcaagcccgccgcaaactcgaagcg
gcctggacccaggtcgctgcgcatctgcaggtccatggcccctatctgctgggacacacc
ttgtcggcggccgatttcatgttgaccatgctgatgcgctggtcgcgcaacatgccacgc
ccgaccgatacctggccggcgctgcaggcgcatgcaacgctgatgaaggcgcgcccagcg
ttccaggaaacctatcgccgggaaggcctgaccgactggacctga

DBGET integrated database retrieval system