KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO2428Help
Entry
XOO2428           CDS       T00235                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00380  Tryptophan metabolism
xoo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XOO2428
Enzymes [BR:xoo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     XOO2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAW75682
UniProt: Q5H039
LinkDB All DBs
Position
2587206..2588477
Genome map
AA seq 423 aa AA seqDB search
MTDLLSRAHADALDAADPLRSLRDAFVFPQHGDRDQTYLVGNSLGLQPRAARAMVDEVLD
QWGTLGVEGHFTGPTQWLTYHQLVRDALARVVGAQPGEVVAMNTLSVNLHLMMASFYRPT
HERGAILIEAGAFPSDRHAVESQLRLRGLDPATHLIEVEADEPNGTLSMAAIADAIAQHG
PRLALVLWPGIQYRTGQAFDLAEIVRLARAQGAAVGCDLAHAVGNIPLTLHDDGVDFAVW
CNYKYLNAGPGAVGGCFVHERHANSDLPRIAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLTLFDQAGMAALRAKSERLTGHLEQLIRARVPQVLQIVTPAEPMHRG
CQLSLRVAGGRAQGRSLFEHLHAAGVLGDWREPDVIRIAPVPLYNRFSDLHTFVGQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgctgtcccgcgcccatgccgatgccctggatgccgccgacccgctgcgc
agcctgcgcgatgccttcgtgttcccgcagcacggcgatcgggatcagacgtatctcgtc
ggcaactcccttggcctgcagccgcgcgcggcgcgcgcaatggtggacgaagtgctcgat
cagtggggcacgttgggggtggaaggtcacttcaccggccccacccaatggctgacctat
caccagctggtacgcgatgcgctggcccgcgtggtcggcgcgcaacccggcgaggtggtg
gcgatgaacaccctcagcgtcaatctgcacctgatgatggctagcttttatcgtcccacg
cacgaacgcggcgcgatcctgatcgaagccggcgcgtttccgtccgaccgtcacgcggtg
gaatcgcagctgcgcctgcgcgggctggacccggccacgcatctgatcgaagtggaggcc
gacgaacccaacggcacgttatcgatggccgccattgccgatgccatcgcgcagcatggt
ccgcgcctggcgttggtgctgtggccgggcatccagtaccgcaccgggcaggccttcgac
ctggccgagatcgtgcgactggcgcgggcgcaaggcgcggcggtgggctgcgatctggcg
catgcggtgggcaacatccctctgaccctgcacgacgatggcgtggatttcgcagtgtgg
tgcaactacaaatatctcaacgccggccccggcgcggtgggcggttgcttcgtgcacgaa
cgtcatgccaacagcgatctgccgcgtatcgccggctggtggggacatgagcagcagacc
cgcttccgcatggacccgcagttcgtgccctcgcccggtgccgaaggctggcagctgagc
aatcccccggtgctggcgctggcgccgctgcgcgcatcgctgacgttgttcgaccaggcc
ggcatggccgcgctacgcgccaaatccgaacgactcaccgggcatctggagcagttgatc
cgcgcgcgcgtgccgcaggtgctgcagatcgtcaccccggccgaaccgatgcaccgcggc
tgccagctgtcgttgcgggtggccggcggacgcgcgcaggggcgctcgctgttcgagcat
ctgcatgcagccggcgtgctcggcgactggcgcgaaccggacgtgatccgcattgcgccg
gtgccgctgtacaaccgcttcagcgatctgcacaccttcgtgggccaggtggaagcctgg
gcggctgcctga

DBGET integrated database retrieval system