KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3043
Entry
XOO3043           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3043 (VgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3043 (VgrG)
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3043 (VgrG)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AAW76297
UniProt: Q5GYC4
LinkDB
Position
complement(3272286..3274334)
AA seq 682 aa
MWHRDYRFPCTPARPAKSSHAIDLCAYVPQDHSGSLTMAHAITLQSPLGKTLRFVRMSAH
EALGRPYAFALHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGIVAEAEQTGFEQIE
GLRYATYAFSLVPKLWLLGQRRDCRIYKNKSVPELVRALLAEVGCTDVKLRLSASYTPRE
YCVQYRESALDFISRLMEQEGIYYYFAHSASTHTLVLADSLGAHESSAPFAQIPYCPPGQ
KGSRMKDAITDWSLARSAHSTRVRLDDYDYLKPKASLRVDETPAESSGPALGELDVFDYP
GEHLDVAAGRRHAQVRAEALNVAQAQYQGWTDACGLQVGALFKLRDFPLAEHNQEYLVTS
ADTELVEVDYVSGGQTVAEPFASTFRALRSRQPFRTPQTTPRPSIAGVQTALVDGNKAED
IAVDQYGRVQVNFFWSPPGTPNAVCSCPVRVAQSWAGKRWGAQHIPRVGQEVVVSFLEGN
PDRPLIIGSVYNADQLPPYALPEHRTRSGVKSRSLSGGAEDYNEIRFDDKKGNEELLLHA
QRDLRHEAENDHFVTVDRNETAEIKRERSHTVGGNDRLDVGKTLRIQAGSEIALVTGMAR
LQLKASGEIVLSGTRLTLDGRVSVGIQGGVSVDVSAMANLTLRSNASVLLQSNAVTTARA
NAALLLQSSGPAVLKGTPPIIA
NT seq 2049 nt   +upstreamnt  +downstreamnt
gtgtggcatcgcgattatcgatttccctgcaccccggcgcggccggcaaagtcatcgcat
gccatcgacctttgcgcctatgtaccgcaagaccactccgggagcctgaccatggcccac
gccattaccctgcagtcgccgcttggcaagacgctgcgctttgtgcggatgagcgcgcac
gaggcactggggcggccctatgcgttcgcgttgcacggcatcagccgcgatgtggcgatc
gacctgcgcgctctgctgggcaagccgatggcggtcaaggtcacttcaccgcagggctat
gtgcggcattaccacggcatcgtcgccgaggcggagcagaccgggttcgagcagatcgag
gggctgcgctacgccacctatgccttctcgctggtgcccaagctgtggttgctcgggcag
cgccgcgattgccgcatctacaagaacaagagcgtgccggagctggtgcgcgcgttgctg
gccgaggttggatgcaccgacgtgaagctgcgcctgagcgcgagctacacgccgcgcgaa
tactgcgtgcagtaccgcgagagcgcgctggacttcatcagccgcttgatggagcaagag
ggcatctactactacttcgcacacagtgccagcacgcatacgctggtgctggccgacagt
ctcggcgcgcacgaatcctctgcgccattcgcacaaatcccttactgcccgcccgggcag
aagggcagccggatgaaggacgcgatcaccgattggtcgctggcgcgcagcgcgcacagc
acgcgcgtgcgcctggacgactacgactatctcaagcccaaggcctcgctgcgggtggac
gagacaccggccgagtcttcgggaccggcgctgggcgagctggatgtgttcgattatccc
ggcgagcatctcgatgtcgcggccggtcgtcgtcacgcgcaggtgcgtgccgaagcgctc
aacgtggcgcaggcgcaataccagggctggaccgatgcctgcggtttgcaggtgggcgca
ttgttcaagctgcgcgactttccgctggccgagcacaaccaggaatacctggtgaccagc
gcggacaccgaactggttgaagtggattatgtgtccggtggccagacggttgccgagccg
tttgcgtccaccttccgtgcgctacgcagtcggcagccgtttcggaccccgcagaccacg
ccgcgtccgagtattgccggggtgcagaccgcgctcgtcgacggcaacaaggccgaggat
attgcggtcgatcagtacggccgtgtgcaggtgaatttcttctggagtccgccgggaacg
ccaaacgccgtctgctcgtgcccggtacgcgtggcgcagtcgtgggcgggcaaacgctgg
ggcgcgcagcacattccgcgtgtgggccaggaggtggtggtgagctttctggaaggcaat
ccggatcgtccgctgatcatcggcagcgtctacaacgccgaccagctgccaccgtatgca
ctgcccgagcaccgcacccgtagcggggtaaagagccgcagcctgtcgggtggggcagag
gactacaacgagatccgtttcgacgacaagaagggcaacgaagagctgctgctgcatgcg
cagcgcgatctgcgccacgaagcggagaacgaccatttcgtcactgtcgaccgcaacgaa
accgccgagatcaaacgcgaacgcagccacaccgttggcggcaacgaccgtctggacgtg
ggcaagacactccgcatccaggcagggagcgagatcgcgttggtgaccgggatggctcgc
ctgcagttgaaggccagcggcgagatcgtgctcagcggcacccggctcacgctcgatgga
cgcgtcagcgtcggcatccagggtggcgtcagtgtcgatgtcagcgcgatggccaacctg
accctgcgctcgaacgcgtcggtgctgctgcaatccaacgccgtgaccaccgcgcgcgcc
aacgcggcgctgctgttgcagtcgtcaggtccggccgtgctcaagggcactccgcccatc
atcgcttga

DBGET integrated database retrieval system