KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3470
Entry
XOO3470           CDS       T00235                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr
Other DBs
NCBI-ProteinID: AAW76724
UniProt: Q5GX47
LinkDB
Position
complement(3714021..3715082)
AA seq 353 aa
MFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASTLTLGHLKGGHDNLREG
ERGYGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQ
AGLPSEPESLPTQDGLKTLQDHLQATHSGSAAGAIGGGAGEVPGWSAPVLLGSGQAGVMS
LTPADQVWVSGTQTALLAGSALNWLSQGHLVLAVAGGLVLYTQGSKAAAGSPNQETGIAL
HAAQGTLSARAHKNTATLAAKTQVRIVSTTADVQLAAPTRHLLATAAGAYIKLDGDDIEL
GAPGTIAFKGGQQVLTAPQGASMSPVTPSASHKLCEYTARAADFAGAGTMGAA
NT seq 1062 nt   +upstreamnt  +downstreamnt
gtgttcaccgggttcaagagccaggcgctggcgcagagccaggacggcaccggcggctac
cagcagctgcggctggacgacacccccggccagggccgcgcgcagctgtcgaccacccag
cacgccagcaccttgaccctgggccacctgaagggcggccacgacaacctgcgcgaaggc
gagcgcgggtacggggcggacctgtccacgcaggcctacggcgcggtgcgcgccggccag
ggcctgctgctgagcagcgagccgggcaacacccaactggccgccaccggcgcgctgagt
caactgcagcagggcagcgacctgctcaagcgcctcaacgacgccgcccgcacccagcag
gcgggcctaccgagcgaaccggagtccctgccgacccaggacggcctgaagaccttgcag
gaccacctgcaggccacccacagcggcagcgcggccggcgcgatcggcggtggcgccggc
gaggtgcccggctggagcgccccagtgctgctgggcagcggccaggccggcgtgatgagc
ctgacccccgccgaccaagtgtgggtctcgggcacccagaccgcgctgctggccggcagc
gcactgaactggctgagccagggccacctggtgctggcggtggccggcgggctggtgctg
tacacccagggcagcaaggccgccgccggcagcccgaatcaggaaaccggcatcgccctg
cacgccgcgcaaggcacgctcagcgcccgcgcgcacaagaacaccgccaccctggccgcc
aagacccaggtgcgcatcgtcagcaccaccgccgacgtccagctcgccgccccgaccagg
cacctgctggccaccgcggccggcgcctacatcaagctggacggcgacgacatcgaactg
ggcgcgccggggacgatcgcgttcaagggcgggcagcaggtgttgacggcgccgcagggg
gcatccatgagccccgtgacgccatccgccagccacaagctgtgtgaatacaccgcccgc
gcggcagatttcgccggtgcagggacgatgggggccgcctga

DBGET integrated database retrieval system