KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3471
Entry
XOO3471           CDS       T00235                                 

Definition
(GenBank) unknown protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3471
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3471
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3471
SSDB
Motif
Pfam: Phage_base_V Phage_GPD
Other DBs
NCBI-ProteinID: AAW76725
UniProt: Q5GX46
LinkDB
Position
complement(3714076..3716028)
AA seq 650 aa
MGPIYCSAASARSPAGAEGTPLGDIGAEDVDTAGPYGWQDSMRGQRRAQQQFDAQQVAAQ
TIQGQGTWRQLAPGTRFGLSQHAVVAADAQFLCLQVRHQARNNLGAEVFDALEQALGAVA
VAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTEDGHGLRLHPKPTV
VGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWVRV
MTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQRRGGAQPGRRRRGRG
HRQCAGVVPGQRARCGVHRVQEPGAGAEPGRHRRLPAAAAGRHPRPGPRAAVDHPARQHL
DPGPPEGRPRQPARRRARVRGGPVHAGLRRGARRPGPAAEQRAGQHPTGRHRRAESTAAG
QRPAQAPQRRRPHPAGGPTERTGVPADPGRPEDLAGPPAGHPQRQRGRRDRRWRRRGARL
ERPSAAGQRPGRRDEPDPRRPSVGLGHPDRAAGRQRTELAEPGPPGAGGGRRAGAVHPGQ
QGRRRQPESGNRHRPARRARHAQRPRAQEHRHPGRQDPGAHRQHHRRRPARRPDQAPAGH
RGRRLHQAGRRRHRTGRAGDDRVQGRAAGVDGAAGGIHEPRDAIRQPQAV
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggggccaatatattgcagtgccgccagcgctcgcagcccggccggcgccgaaggcacg
ccgctgggcgacatcggtgccgaggacgtggacaccgccgggccgtacggctggcaggac
agcatgcgcggccagcgccgcgcgcagcagcagttcgatgcgcagcaggtggcggcgcag
accatccagggccaggggacctggcgccagctggcgccgggcacgcgtttcgggctgagc
cagcatgcggtcgtggcggccgatgcgcagttcctgtgcctgcaggtgcggcaccaggcg
cgcaacaatctgggcgcggaggtgttcgacgcgctggagcaggcgctgggcgcggtggcg
gtggccggcgcgccgctgccgccagcgctggcaggcctgagcggcgggtatgcgccggcg
caggatgaggcggcggtagagttctaccgcaaccagttcaccgccataccggccaccgcg
acctaccggccgcaaaccgaggacggccatggcctgcgcctgcatcccaagccgacggtc
gtcggcacgctgagcgcgatcgtggtcagcgacggcgacccggtgcagtccgaccgcgac
caccggatcaaggtgcagttcccgttccagcgcggggccgacgccagcagcgcgctggcg
catccggggggcgaggacaacgcgccgggcagcgcctcggcgtggacctgggtgcgggtg
atgacgccgtgggccggggacaactggggcggcgtggtgctgccgcgcaagggccaggaa
gtgctggtggggttcctggaaggggacatcgaccggccggtggtgatcggcagcgtgtac
aacgggcgcggccagcgacgaggcggcgcacaaccaggtcggcggcggcggggccggggc
caccggcaatgcgccggcgtggttccagggcaacgcgcacggtgcggtgttcaccgggtt
caagagccaggcgctggcgcagagccaggacggcaccggcggctaccagcagctgcggct
ggacgacacccccggccagggccgcgcgcagctgtcgaccacccagcacgccagcacctt
gaccctgggccacctgaagggcggccacgacaacctgcgcgaaggcgagcgcgggtacgg
ggcggacctgtccacgcaggcctacggcgcggtgcgcgccggccagggcctgctgctgag
cagcgagccgggcaacacccaactggccgccaccggcgcgctgagtcaactgcagcaggg
cagcgacctgctcaagcgcctcaacgacgccgcccgcacccagcaggcgggcctaccgag
cgaaccggagtccctgccgacccaggacggcctgaagaccttgcaggaccacctgcaggc
cacccacagcggcagcgcggccggcgcgatcggcggtggcgccggcgaggtgcccggctg
gagcgccccagtgctgctgggcagcggccaggccggcgtgatgagcctgacccccgccga
ccaagtgtgggtctcgggcacccagaccgcgctgctggccggcagcgcactgaactggct
gagccagggccacctggtgctggcggtggccggcgggctggtgctgtacacccagggcag
caaggccgccgccggcagcccgaatcaggaaaccggcatcgccctgcacgccgcgcaagg
cacgctcagcgcccgcgcgcacaagaacaccgccaccctggccgccaagacccaggtgcg
catcgtcagcaccaccgccgacgtccagctcgccgccccgaccaggcacctgctggccac
cgcggccggcgcctacatcaagctggacggcgacgacatcgaactgggcgcgccggggac
gatcgcgttcaagggcgggcagcaggtgttgacggcgccgcagggggcatccatgagccc
cgtgacgccatccgccagccacaagctgtgtga

DBGET integrated database retrieval system