KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3473
Entry
XOO3473           CDS       T00235                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3473
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3473
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr
Other DBs
NCBI-ProteinID: AAW76727
UniProt: Q5GX44
LinkDB
Position
complement(3720130..3721437)
AA seq 435 aa
MDLGAGDDAVGRGQLGRRGAAAQRPGSAGGVPGRGHRPAGGDRLSVYNGRGQDDAAHNQV
GGGGAGATGNAPAWFQGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLST
TQHASTLTLGHLKGGHDNLREGERGYGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGA
LSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQDGLKTLQDHLQATHSGSAAGAIGGG
AGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALNWLSQGHLVLAVAGGL
VLYTQGSDPVAGSPNQERGIALHAAQGTLSARAHRNTATLAAKTQVRIVSTTADVQLAAP
TKHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGFSTRVQLPSADKPVCLEC
MRDLATRHEAVASRG
NT seq 1308 nt   +upstreamnt  +downstreamnt
gtggacctgggtgcgggtgatgacgccgtgggccggggacaactggggcggcgtggtgct
gccgcgcaaaggccaggaagtgctggtggggttcctggaaggggacatcgaccggccggt
ggtgatcggctaagcgtgtacaacgggcgcggccaggacgacgcggcgcacaaccaggtc
ggcggcggcggggccggggccaccggcaatgcgccggcgtggttccagggcaatgcgcac
ggcgcggtgttcaccgggttcaagagccaggcgctggcgcagagccaggacggcaccggc
ggctaccagcagctgcggctggacgacacccccggccagggccgcgcgcagctgtcgacc
acccagcacgccagcaccttgaccctgggccacctgaagggcggccacgacaacctgcgc
gaaggcgagcgcgggtacggggcggacctgtccacgcaggcctacggcgcggtgcgcgcc
ggccagggcctgctgctgagcagcgagccgggcaacacccaactggccgccaccggtgcg
ctgagccaactgcagcagggcagcgacctgctcaagcgcctcaacgacgccgcccgcacc
cagcaggcgggcctaccgagcgaaccggagtccctgccgacccaggacggcctgaagacc
ttgcaggaccacctgcaggccacccacagcggcagcgcggccggcgcgatcggcggtggc
gccggcgaggtgccaggctggagcgcaccggtgctgctgggcagcggccaggccggcgtg
atgagcctgacccccgccgaccaggtgtgggtgtcgggcacccagaccgcgctgctggcc
ggcagcgcactgaactggctgagccagggccacctggtgctggcggtggccggcgggctg
gtgctgtacacccagggcagcgacccggtcgccggcagccccaaccaggagcgcggcatc
gccctgcacgccgcgcaaggcacgctcagcgcccgcgcgcacaggaacaccgccaccctg
gccgccaagacccaggtgcgcatcgtcagcaccaccgccgacgtccagctcgccgcgccg
accaagcacctgctggccaccgcggccggcgcctacatcaaactggacggcgacgacatc
gaactgggcgcgccgggggtggtcgcgttcaagggcgggcagcaggtgttgacggggccg
cagggctttagcacccgcgtgcagctgccctcggcggacaagccggtgtgcctggaatgc
atgcgcgatcttgcaacccggcacgaagccgtcgcatctcgcgggtga

DBGET integrated database retrieval system