KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3480
Entry
XOO3480           CDS       T00235                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3480
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3480
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AAW76734
UniProt: Q5GX37
LinkDB
Position
complement(3730354..3731850)
AA seq 498 aa
MAAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVV
SDNLNLTLDARIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVF
NSPQRDLVRDFKSAIDFDQSALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQ
MSHVAAAAHAPFISAASESMFGLETFTDLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVG
LTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWCNTAYAMATRLTKAFEDYGWC
AAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNTD
YAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDE
LSVSLRLVAELPAGTKKA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggccgcagaggtttcgagtgccacccacaattcggcgcccgccgcgctggcagaaaca
ggcttgctcgaccagatcgtcgagcagagcaaggtcgccaaatcggagaccgagcaccag
cgtgcgaaggacatcatctccgagctggccaaggaggtgctggaaggtaccgtcgtggtg
tcggacaacctcaatctgacgctggacgcgcgcattgccgagatcgatcggatcatctct
gagcagctgagcgcggtgatgcatgcgccggagttccagaagctggagagcagctggcgc
ggcctgcactacatgtgcgagcagacgtccaccggcgtgacgatgaagatcaaggtcttc
aactcgccccaacgggatctggtgcgcgacttcaagtcggcgatcgacttcgatcaaagc
gcgctgttcaagaaggtctacgaggaagagttcggcaccttcggcggtgcgccattcggc
gcactggtcggcgactactacatcggccgccagccggaggacatgtacttcgtcgagcag
atgtcgcatgtggccgccgcggcgcacgcgcccttcatctctgccgcgtctgaatcgatg
tttggtctggaaaccttcaccgacctgggcaaaccgcgcgatctggccaaggtgttcgac
actgtcgaatacgccaagtggaagtcgttccgtgagtcggaggatagccgctacgtcggc
ctgaccatgccgcgttttctcgggcggctgccgtacaacccgaaggacggcactacggtc
gaaggcttcaacttcgtcgaagacgtcgacgctgccgaccatagcaagtatctgtggtgc
aacaccgcttatgcgatggccacgcgcctgaccaaggcgttcgaggactacggttggtgc
gcggcgatccgcggtgtggaaggcggtggcctggtcgaagacctgccgacccacaccttc
cgcaccgacgacggcgaagtggcgctgaagtgcccgaccgagatcgcgatcaccgaccgc
cgcgagaaggaactcagcgacctgggcttcatcccgctggtacattgcaagaacaccgac
tacgcggcgttcttcggtgcgcagtcggcgcagaagccgaagaagtacaacaccgatgcg
gccaatgccaacgcgatcctgtcggcgcagctgcagtacatgttcgccgtgtcgcgtatc
gcccattacctcaaggcgatgatgcgcgagaagatcggcagtttcgcctcggcgcgtaat
gtcgaggacttcctgaaccgttggatctcccagtacgtgttgttggacgacaacgccggt
caggaagcaaaggcgcaataccccttgcgggaagcgtccgtacaagtttcggaagtgccg
gggaaacccggtgtctaccgcgcggtggccttcatcaggccgcatttccagctcgatgag
ctgtctgtttcgttgcgtctggtggccgaactgccggctggtaccaagaaggcgtag

DBGET integrated database retrieval system