KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3481
Entry
XOO3481           CDS       T00235                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3481
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3481
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAW76735
UniProt: Q5GX36
LinkDB
Position
complement(3731854..3732354)
AA seq 166 aa
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDR
KFVNVDLDNFDEVMEGMAPRAVYRVPNKISDAGGEFRVELKFKSIDDFRPEAVVDQVEPL
RKLLESRTKLADLRNKLAGNEKLEDLLTDVLNNTEQLKKLGREKEK
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctaagaaggaaagcatccagaaacgtctgcagaagattcggccgccgcgcgtgcag
ctgacctacgacgtggaaaagggtgacgcgatcgaacagaaggagctgccgttcgtggta
ggcgtgcttggggatttcagcggcaatcccgaacagcccctggccaaggtcaaggaccgc
aaattcgtcaacgtcgacctcgacaacttcgacgaggtgatggagggaatggcgccgcgc
gcggtttaccgtgtgccgaacaagatcagcgatgccggcggcgagttccgcgtcgaactc
aagttcaagtcgatcgacgacttccgtccggaggctgtggtcgatcaggtcgaaccgctg
cgcaagctgctggaatcgcgcaccaagctggcagacctgcgcaacaagctggccggcaac
gagaagctcgaagacctgctaacggacgtgttgaacaacaccgaacagctgaagaagctg
ggtcgggaaaaggagaagtaa

DBGET integrated database retrieval system