KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3483
Entry
XOO3483           CDS       T00235                                 

Definition
(GenBank) putative transmembrane protein
  KO
K11906  type VI secretion system protein VasD
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3483
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3483
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AAW76737
UniProt: Q5GX34
LinkDB
Position
3733231..3733884
AA seq 217 aa
MAGCGSSSVRHFRTSMNISAHRFNFLLVLIVAALALSGCASGGIGKAMDKTLQAVGIKEA
KPEASPMIPLRLFAGSNLNAGSDTHATAAVVKIYHLRSAQRFEQAAFNAFLDQAGEQAAL
GADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVGLFRAPAEGRWRMAFDTRRKELPTQG
ITIGIHACALTTASPALVTRLAGDPSSLASVRCAAAR
NT seq 654 nt   +upstreamnt  +downstreamnt
gtggctggatgtggatcgtcctccgtccgccacttcagaacaagcatgaacatatccgcc
caccgtttcaattttctgttggttcttattgtagccgccctagccctgtcaggctgcgcc
agcggcggcatcggcaaggcgatggacaagaccctgcaggcagtgggcatcaaggaagca
aagccagaggcgtctccgatgattcccctgcggctgtttgccggcagcaacctgaatgcg
ggcagcgacacgcacgccaccgcagcggtggtcaagatctatcacctgcgcagcgcgcaa
cgcttcgagcaggccgcgttcaacgcgttcctcgatcaggccggagagcaggcggcgctg
ggcgcggacctgctgtcggtcaacgagatcgttctgacgccaagcgcccgccaggaactg
aacgagcagatgtccgaaggcaccaccaccctgggcgtggtgggcttgttccgcgcgccg
gccgagggccgctggcgcatggccttcgatacgcgacgcaaggaattgccgacccagggc
atcaccatcggcattcacgcctgcgcgctgaccaccgccagcccggcgctggtcacccgc
ctggcgggcgatcccagcagcctggcgtcggtgcgttgcgccgctgcgcgctag

DBGET integrated database retrieval system