KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3484
Entry
XOO3484           CDS       T00235                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3484
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3484
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AAW76738
UniProt: Q5GX33
LinkDB
Position
3733943..3735370
AA seq 475 aa
MDARPCLSRPAGSVRTDFFKSRDRPVSHVSRMSKVFWGEGLFLRPQHFQRQDTYHEARLQ
DLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGESYDAPAHDALPDALSLNDL
PAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTSDLYTDAAQSELAYLSKAV
KLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQA
KVDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLR
MAGALLTFSNAYQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSF
HLGRIDSQRIDENAAFYLSVSADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTH
AAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYVPSGIDDLKMELVAVTS
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggacgcgaggccttgcctctcgcggccggccggatcggtgcggaccgacttcttcaaa
tccagggatagacccgtgtctcatgtaagcaggatgtcgaaagtattttggggcgaaggt
ctgtttttgcggccgcagcatttccagcgccaggacacctaccacgaagcaaggctgcag
gatctggcgcagacgctgcatccctatggctggggaacgcgccggatccgtttcgatccg
cagagcatggctagcggcagcttgcgcgcgctcgccctgtcggtggtctttcccgatggc
gaatcgtacgacgcgccggcgcacgacgcgctgcccgatgcgctgtcgctgaatgacctc
cccgccggcatccagaccaccacggtgtacctggcgctgccgttgctgcgcgacgacggc
ggcaactgtagcgatgcggagggttcgcaactggcccgctaccagcagctcaaccggccg
accagcgacctgtacaccgacgcggcccaatcggaactggcgtacctgagcaaggcggtg
aagctgctcaccgacgacactccgcgcgatccgtacgtgaccgtgccggtggcgcgcgtg
cgccgtaccccgaccggcggcttcgagctggacgaggacttcatcccgtcatgcgcgcac
atcgacgcctcgccgacgctgtatcgcgaactgcgcggcctgctcgactcgctgcaggcc
aaggtcgatgcgctgtacgggctgcatcggcaatcgtcgcagcacatcatcgaattccgc
tccggcgacatcgcctcgttctggctgctgcataccgcctgttcctcgttcggcgcgctg
tcgcacctgttccatcatccgcagctgcacccggagcgcttgtaccaggaactgctgcgc
atggccggcgcgttgctgacgttctccaacgcctaccagctcaacgacctgccccggtac
aaccacgcggcgccggaagcctgcttccagcgcctgttccagatcgtgcgcgacctgctc
gacacggtgatctcggcgcgctatttcaagatcgcgctgaccgaggtcaagccgtcgttc
cacctgggccggatcgattcgcagcggatcgacgagaacgccgcgttctacctgagcgtg
tcggccgacatgcccgggccggaactggtgcagacggtgccggtgcggttcaagatcggt
gcgccggacgacgtcgagaagtgcgtgctgtcggccctgccgggcgtgaaactgacccac
gccgcgcaggtgccggcagcgatcccggtccgtcccggcagctactatttcgccctggaa
gcgcgcgggccgctgtacgagcgcatgctcaaggcgcagtctatgatgctctatgtgccg
tcaggcattgatgacctcaagatggaacttgtcgcggtaacctcatga

DBGET integrated database retrieval system