KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3486
Entry
XOO3486           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3486 (VgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3486 (VgrG)
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3486 (VgrG)
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V DUF4178 Sarcoglycan_1
Other DBs
NCBI-ProteinID: AAW76740
UniProt: Q5GX31
LinkDB
Position
3736169..3738706
AA seq 845 aa
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFL
DAEALLEQPLDLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNA
LVFQDLDARAICERIFADYPQAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAW
RYAHAQDADSQATAATLVIFDPQAQVPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTAS
TVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHT
LHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVALLDAPELEHGS
YRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQ
PRITGQLYNGELAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLH
TSLADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTAL
DVAEAVAQLHGAQRTVQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQP
ATKPGDGGRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAG
QTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQ
HKIVLQAGQTRITLEGGDISFACPGQFTVKASTHPFLGGESGNPQFALPDGLVHLEPDRM
LDFSG
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggatatcccgacgctggccgtcgccctggctagtctggcgcagccgtcccaacatgcc
cgcctgatccaactgcgcgccccggtcgaggggctggtggtggaacgcttccacgggcag
gaggcggtgtgcggcgccaccgtgctgcagatcgcgtgcctggccacctcggcgtttctc
gatgccgaggcgctgctggagcagccactggacctgcagctgcgccaggccgacggcacg
caacgccactggcagggcctgtgcaccgaagtggcgcaactgggcggcgacggcggcctg
gcccgctaccggctgaccctggcgccgtggacggcgctgctggagctgcggcgcaacgcg
ctggtgttccaggacctggacgcgcgcgcgatttgcgaacggatcttcgccgactacccg
caggccgcgttccgcttcgacgtgcaggccgcgttgccggcgcacccgatcaccacccaa
taccgcgagaccgactgggccttcgtcacccgcctgctggccgaggccggcctggcctgg
cgctacgcgcacgcgcaggacgccgacagccaggccaccgcggccacgctggtgatcttc
gacccgcaggcgcaggtgccggacagcggcacgatccgcttccaccgcagcgacctggcc
gaggccgacgatgcgatcggcgccttcggcgagcgccgcggcgtcgtgcccaccgccagc
acggtgaccagctggcacagcgagcaagtgcgcgcggtcggcgcgcaggcccaggccgag
gccggcgggctgccgccgctggaggtctacgtgcagccgcgcgccgggcgtttcgcccag
gaagcgacagcgcaggatcaggcgcaggcgcggctggacgcgctgcgcgtgccgcacacg
ctgcacgccggggccggcagcgcccgcgtgctggcggccggggcggcgttcaccttgcgc
cagcacgcccagcacgacggccagcgtttcgttccggtggcgatcgagcacgtggcggtg
aacaacctgggccagggcatcgtcgccctgctggacgcgccggagctggagcacggcagc
taccgcaaccgcttcctggcggtgccggcggccacgccgctgcgcgcgctgccgcaggac
cgcccgcgcatgcccgggccgcagagcgcgcgcgtggtcggcgtggccgacgcggcgctg
agcccgagccgcgaccaccaggtgcggatccagttcccgtggcagcgcggcgaccagccc
accccgggcgggttgaccgacagcgccagcaccgcgcccggccacgcgccgggcgaccag
cgcgccggcacctgggtgccggtggccgagtgggtggccggcccgaactggggcagccac
ttcctgccgcgcatcggcagcgaagtgctggtggagttcctgcacggggacatcgatcag
ccgcgcatcaccggccagttgtacaacggcgagctcgccccacccttcggcgggggcctg
gacgcgcgtgccagccaccccggcacgctcagcggcctgcacacccagtcccacgacggc
agcggcacccagcaatggctgctggacgacactcccggccagctgcgcacgcgcctgcac
acctcgctggccgacacccggctggaactgggctacctggtccagcacagcgacaccgcc
cgcggcgcgctgcgcggccagggcttcgaactggcctcccagggctggggcaacgtgcat
gccgcgcaaggcctgctgctgtccagcagcgcccgcggccagggcgcctcgaccgcattg
gacgtggccgaggcggtggcccagttgcacggcgcccaacgaaccgtccaggcgctgcac
gccaccctgacccagcaacaggtgcccggcctggacgcccatcccagcgtgacccggctg
cgcgaggccatcgacccgcaggcgcagggcaagtacaccgctgcggtcggcggccagccg
gcgaccaagccgggcgacggcggccgcgacggccaggcaccggtggaacgcttcgcccag
gcgcgcctgctcggcgagtcgccggaccacatcgcctggaccaccccggccagcgcggtg
gcctatgccgggcaggccctgcagttgaccgtgcagcaggatgcgcagctgagcgccggg
cagaccctgtcggcggtgtccggccagcacaccgcgctgttcgcccaacgcggaccgatc
aaactcatcgccgccgccggcccggtgagcctgcaggcacataccggcgcgctggaactg
ctggccgaccaggcggtgaccgtcaccgccaccgacacccgcatcgacgtgctggcgcag
cacaagatcgtgctgcaggccggacagacccgcatcaccctggaaggcggcgacatcagc
ttcgcctgcccggggcagttcacggtcaaggccagcacgcatccgttcttgggtggggag
agcggcaacccccaattcgccttgcccgatgggctggtgcatctggaaccagaccgcatg
ctcgatttctcgggctga

DBGET integrated database retrieval system