KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3487
Entry
XOO3487           CDS       T00235                                 

Definition
(GenBank) EF hand domain protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: Glyco_hydro_19 EF-hand_6
Other DBs
NCBI-ProteinID: AAW76741
UniProt: Q5GX30
LinkDB
Position
3738731..3741625
AA seq 964 aa
MADTEQKKLAKISKLVHPFQKSAKAGKAGAKPTDIDDPQVYFDALSNAQDGFYPIGANGQ
WHGGIHFDTQTGNTLAQEDGIRCIGDGEVVAYQIDAKYPSIEYSAGKATYSRGFVLVRHR
LELPPAPKQTAQPAPAGPSAANTAPATPQPVAQPAATLDQKAQEPSLIFYSVYLHLLDWA
GYQADPKKPRPAFWKSVAYMVGDKAKDSDRVSNPSIPEGGVGLNLRDAQHQKVGYAPRGA
KLRLGAENPNKKGYFVISEVVSGQTVPADAKGLYAYKAELTAAGAEPDRQDAVYVLPTPA
PIKAGDLIGYLGHYQRFADLTPLAAAGPAQNGVRPLIQLDVFTAEDLKTFIAKSRERAKL
LDAKQKTLLKIDVGAKLVLPSEPDQQIGAEEAAAVVPGGKVGAWVQVRKGTLQIMDKDSL
SGFNSTTHTYGGGQILHRVLGASDSDSITEAAYNALKTKEEKDKYPRRQVLVPSGAPVWV
DKAMMGADASVAGRSLKAWSTFPLQASQANGPEAGFIRVAAIKTLKKVATEPDGTRWWEV
DVGKIDGSSAVGWAREKDHAKVTRCSPWEWPGFEFIEADGTTPEALYARHVVATKQAKPD
EQAALEAKAAQANGGPLFSRVCDAIDLDDDRHLTPAELRKALKQPWLAEAISRLVFHHTS
EWGTPRAQWNAIDGDIPESRKADWEKEKDRIESLQWWSDVKTTPALPGDAKVYAFHPIGL
ISNFSSPSECCQLTMASFRSIFGDRKIFNHRDMPRGGDTYEADIQKFIDLLNDGFSKNGF
ETCIYKQHFLAQCYHESDHFNTTIEYASGLDYDLSKYPTSVCDVNSSEYDKKKCRRRNQI
IQEGNTTIGDGPTYKGKGIIQLTWKGTYNAYKEYSGSDVVSNPMKVAEDLATAVSTAFWF
WAKFKGEDLNRKIDRYYEEGAKSGLNSEALDDDVVRRLTKIINGGDRGLSERQNLLKKIK
KEMQ
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcagataccgagcagaagaaactggcgaagatcagcaaattagtccatccgttccag
aaaagcgcaaaggcaggcaaggccggcgccaagccgaccgacatcgacgatccgcaggtc
tatttcgatgcgctttccaacgcacaggacgggttctaccccatcggtgccaacgggcaa
tggcacggcggcatccatttcgatacgcaaaccggcaacaccctggcgcaggaagacggc
atccgctgcatcggcgatggcgaggtcgtggcgtaccagatcgatgcgaagtaccccagc
atcgagtacagcgccggcaaggccacctactcacgcggcttcgtgctggtccgccaccgc
ctggagctgccgcctgcgcccaagcagaccgcgcagcctgcccctgctggaccgagcgcg
gccaacacggcaccggctacgccacagccggtagcccagcctgcggcaacactcgatcag
aaggcgcaagagccttcgctgatcttctacagcgtctatctccacctgctcgactgggcc
ggctaccaagccgatccgaagaagccgcgcccggcgttctggaagagcgtggcctatatg
gtcggcgacaaggccaaggacagcgacagagtctctaacccttccattccggaaggaggc
gtaggccttaacctgcgcgacgcgcagcatcagaaggtcggctatgcgccacgcggcgcc
aagctgcggcttggcgccgaaaatcccaacaaaaagggctatttcgtcatctccgaggtc
gtcagcgggcagaccgttcctgccgacgcaaaaggcctgtatgcctacaaggcagagctg
accgccgccggcgccgagcccgaccgccaggacgcggtctatgtgttgccaacccccgcc
ccgatcaaagccggcgacttgatcggctatctcggtcactaccagcgctttgccgatctc
acgccattggcggcagccggccccgcgcagaatggcgtgcggccactgatccagttggac
gtattcaccgcagaagatctcaagaccttcatcgccaagagccgtgagcgggcgaagctg
cttgatgccaagcaaaagaccctgctcaagatcgacgtgggcgccaagcttgtgctgcca
agcgaaccggaccagcagatcggcgccgaggaggctgccgccgtggtccccggcggcaag
gtcggagcctgggttcaggtgcgcaaaggcaccttgcagatcatggacaaggacagcctg
agcggcttcaacagcaccacccacacctacggcggcggccagatcctgcatcgcgtgctc
ggtgccagcgatagcgacagcatcaccgaagcggcctacaacgcgctgaagaccaaggaa
gaaaaagacaagtacccgcgccgccaggtactcgttcccagcggcgcgccggtgtgggtg
gacaaggcgatgatgggcgccgacgccagcgtcgccggccgctcgctcaaggcgtggagc
acgttcccgctacaggccagccaggccaacggaccggaggcgggcttcatccgcgtcgcc
gccatcaagacactgaaaaaggtcgcgaccgaaccggacggcacccgctggtgggaagtg
gatgtgggcaagatcgacggcagcagcgccgtgggctgggccagggagaaggaccatgcc
aaggtcacccgctgctcgccgtgggagtggccgggtttcgagttcatcgaagccgacggc
actacgccggaagcgctgtacgcacgccacgtggtcgccaccaagcaagccaagcctgac
gagcaggccgctttggaagccaaggccgcacaagccaatggaggcccgctgttctcgcgc
gtatgcgacgccatcgacctggacgacgaccgtcatctcacccccgcagaactgcgcaag
gccctgaaacagccctggttggcggaggcgatttcccgcctggtcttccatcacacaagc
gaatggggaacgccgcgtgcgcaatggaacgcgatcgacggcgatatcccagaatcgcgc
aaggcggattgggagaaggaaaaggatcggattgaaagcctgcagtggtggagcgacgta
aaaaccactccggctttgccgggggatgccaaggtttatgctttccatcctattgggttg
attagtaatttttcttctccatcggaatgctgccaacttaccatggcatcgtttcgatct
atttttggagaccgaaagatattcaaccatcgcgacatgccacgcggtggtgacacatac
gaagctgacatacaaaaatttattgacttactcaatgatggattttcaaaaaatggtttt
gaaacgtgcatttataagcagcactttctcgcacagtgctatcacgaaagcgatcacttt
aacaccaccatagaatatgcaagcggtctagactacgacttatcaaaatatccaacttcc
gtgtgcgatgttaatagctcggaatacgacaagaagaaatgcaggcgccgcaaccagatc
atacaagaaggtaataccactattggcgatggaccaacctataagggaaagggaatcatt
cagcttacgtggaaaggcacgtacaatgcctacaaggaatactctggctcggatgttgtg
agcaacccaatgaaggtagccgaagatctagccacagctgttagtacggcattttggttc
tgggcaaaatttaaaggagaggacctcaatagaaagatagatcgctattacgaagaaggg
gctaaatccggccttaattcggaagcccttgatgatgacgttgttagaagattaaccaag
ataattaacggaggagatagagggctttccgaacggcaaaatttgcttaagaaaattaaa
aaggaaatgcaatga

DBGET integrated database retrieval system