KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3497
Entry
XOO3497           CDS       T00235                                 

Definition
(GenBank) unknown protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: DUF2345
Other DBs
NCBI-ProteinID: AAW76751
UniProt: Q5GX20
LinkDB
Position
3757737..3758570
AA seq 277 aa
MPATPARSAACTPSPTTAAAPSNGCWTTPPASCARACTPRWPTPGWNWATWSSTATPPAA
RCAARASNWPPRAGATCMPRKACCCPAAPAARAPRPHWTWPRRWPSCTGAQRTAQALHAT
LTQQQVPGLDAHPSVTQLREAIDPQAQGKYTAAVGGQAATTPADGGRDGQAPVERFAQAR
LLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKL
IAAAGPVSLQAHTGALELLADQAVTVTATATDTRASC
NT seq 834 nt   +upstreamnt  +downstreamnt
atgccagccaccccggcacgctcagcggcctgcacacccagtcccacgacggcagcggca
cccagcaatggctgctggacgacacccccggccagctgcgcacgcgcctgcacacctcgc
tggccgacacccggctggaactgggctacctggtccagcacagcgacaccgcccgcggcg
cgctgcgcggccagggcttcgaactggcctcccagggctggggcaacgtgcatgccgcgc
aaggcctgctgctgtccagcagcgcccgcggccagggcgcctcgaccgcattggacgtgg
ccgaggcggtggcccagttgcacgggcgcccaacgcaccgcccaggcgctgcacgccacc
ctgacccagcaacaggtgcccggcctggacgcccatcccagcgtgacccaactgcgcgag
gccatcgacccgcaggcgcagggcaagtacaccgctgcggtcggcggccaggcagcgacc
acgccggccgacggcggccgcgacggccaggcaccggtggaacgcttcgcccaggcgcgc
ctgctcggcgagtcgccggaccacatcgcctggaccaccccggccagcgcggtggcctat
gccgggcaggccctgcaattgaccgtgcagcaggatgcgcagctgagcgccgggcagacc
ctgtcggcggtgtccggccagcacaccgcgctgttcgcccaacgcggaccgatcaaactc
atcgccgccgccggcccggtgagcctgcaggcgcataccggcgcgctggaactgctggcc
gaccaggcggtgaccgtcaccgccaccgccaccgacacccgcgctagctgttga

DBGET integrated database retrieval system