KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3498
Entry
XOO3498           CDS       T00235                                 

Definition
(GenBank) VGR-related protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: DUF2345 Cthe_2159 DUF3540 ORF_2_N
Other DBs
NCBI-ProteinID: AAW76752
UniProt: Q5GX19
LinkDB
Position
complement(3758605..3758994)
AA seq 129 aa
MACRGCEGKRSNQTLSSLVSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLH
LAVAGGASVTIEGGNITVACPGTITVQASKKSFVGPVNLGYGLPLFPESVCVECMLKAAA
NGSPFAALQ
NT seq 390 nt   +upstreamnt  +downstreamnt
gtggcttgccgaggatgtgaggggaagcgcagcaaccagaccctcagcagcctggtcagc
ggcgaaggcgcgctggacgtgcaggcgcagtcggacgacgtgcgcgtgcagtcgaaagaa
ggcctgaagctgatcagcgccaacgccgacgtggcactggcggcgggcaagaccctccac
ctggcggtggccggcggggccagcgtgaccatcgaaggcggcaacatcaccgtcgcctgc
cccggcaccatcaccgtgcaggccagcaagaagtcgtttgtggggccggtgaacttggga
tatggcctaccgctattccccgaatctgtgtgcgtcgaatgcatgctcaaggcggcggct
aacggctccccgtttgcggcactgcaatga

DBGET integrated database retrieval system