KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3502
Entry
XOO3502           CDS       T00235                                 

Definition
(GenBank) putative VGR-related protein
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: DUF2345
Other DBs
NCBI-ProteinID: AAW76756
UniProt: Q5GX15
LinkDB
Position
complement(3762616..3765474)
AA seq 952 aa
MVVCLAWNRWTILASRRGKGLNGLRPNAIAIKSVYPWCSMRRVRLTQACQGSGSLHFSKE
SDHANAYCQPFVRGLRRRVVGGAAAVRRIRGGIGTEERARSRRRHRRDGDPPWRGRVFGR
RRAVAADRRSVQRDAASERKNRGSGVRRLRADGKLAVERGDERVPGAGAAAQLLRAVPRE
RPGFRAAAAGRGRPGLEAAGGGPVARRAPAGGVRRQRRATAGPQFGAGRRAALPPQRRHR
GGRQRAGDRRHPAAGQRPADGAQRRLQDAPGAQRAVAVARRRQAVAALGVRAGGDGRLRQ
RAGSRPLCGVDGAGARGTVVTVAGPQHGAHAARRHLVHADPGTAAGPGAAGAAVADAGVA
CGYQQLAGGRARGGAVAVGGRAGVAGHQRGGRTQHLGAGRGGGLRQRLRGGGPAAAVAAG
AGRRHRCAAAPAADRAGLPERHRGRCRWQHRRQPGGPCRRAGPDPGQVPLPARRVGPGGA
GQHVAAGGAALRRPGRGQPVPATHRPGSAGGLPGGGHRPSGGAGGAVQRQGRSRRSRHPR
RHQRRGRHRPVRQGRRRQTQRAGQPGRRPCPGLARRRRRRGQPPQRHRAVGRAIQGMGRR
WPQPAGVRRQRPAIALATCDHPGSHATEPGAPDPPGRQLPRQLPRGRLRTAHRRVGRGAG
QLGAMAEQLRPQRRPGRRGDPAQRIAEPAADAGQDVLAGGGHAPDGEAGRARRRGPGEPL
PADRRAGAAAGAADQREDHGAGHGLRRRQGRGGRAPRQPGRRPGAAHRRCAAGPGGASGD
RRGGRPGPGAWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGRQTQANSLSL
VSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITV
ACSGTITVHASKKSFVGPVQHAYPLPAFAKSVCIPCLLQAMGKGHALSPVNG
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggttgtctgtctcgcttggaatcgatggacgatcttagcaagtcgccgagggaaagga
ttgaatggcttgcgtccgaatgccattgcaataaagtccgtatacccgtggtgctcaatg
cgcagagtgcgtctgacacaggcgtgccaaggaagcggaagtcttcatttttccaaggag
agtgatcatgcgaacgcgtattgccaaccattcgtccgtggccttcgtcggcgcgttgtg
ggtggggctgctgctgttcggcgtattcgcggcggtatcggtacagaagagcgtgcgcga
tcgcgtcgacggcatcggcgtgacggcgatccaccatggagaggccgggtgttcggtcgt
cgccgcgctgtcgctgctgaccgtcggtctgtgcaacgcgacgccgcctctgagcgcaaa
aatcgtggaagcggtgttcgccgactacgcgccgatggcaagctggcagtggagcgagga
gacgagcgcgttcctggggcaggcgcggccgcgcagctactgcgtgcagtaccgcgagag
cgacctggatttcgtgcagcggctgctggccgaggaaggcctgggctggaggctgcagga
ggcggccccgtcgcccggcgggcaccagctggtggtgttcgccgacagcgccgcgcaacc
gcaggaccccagttcggcgcagggcggcgggctgcgctaccaccgcagcgacgccaccga
ggcggccgacagcgtgctggcgatcggcgccacccggcggctgggcagcggccggctgac
ggtgctcagcgaagacttcaagacgcgccaggcgcgcagcgcgcagttgccgttgcacgg
cggcggcaggcagtcgctgcgctaggtgtacgagctggtggggatggacgccttcgccag
cgcgcaggcagcagaccgctctgcggagttgatggcgcaggcgcacgaggcacagtggtc
accgtggcagggccgcagcacggtgcgcacgctgcgcgccggcacctggttcacgctgac
ccaggcaccgcagcagggccaggcgccgccggcgcagctgttgctgacgcgggtgtggca
tgcgggtatcaacaacttgccggtggacgtgcgcgcggcggtgcagtcgcagttgggggt
cgcgccggcgtggccggacaccagcgcggtggccgcacgcagcacctgggcgcaggccga
ggcggtgggctacggcaacgccttcgaggcggtggaccggcagcagccgtggcggccggt
gctggccgacggcaccggtgcgcggctgcacccgcggccgaccgcgccgggctaccagag
cgccatcgtggtcggtgccgatggcagcaccgacggcagccaggaggtccatgccgacgc
gctgggccggatccgggtcaggttccacttccagcacgccgcgtcggccccggcggcgca
ggacagcacgtggctgcgggtggcgcagcgctacgccggcccgggcgtgggcagccagtt
cctgccacgcatcggccaggaagtgctggtgggcttcctggagggggacatcgaccgtcc
ggtggtgctgggggcgctgtacaacggcaagggcgaagccggcgttcccgccacccccgg
cggcaccagcgccgaggccgacaccggcctgtacgccaaggccggcgacggcagacccag
cgcgcagggcaacctggccggcggccatgccccggcctggcacggcgccggcggcggcgc
ggacaaccaccgcaacgccaccgcgctgtggggcgtgcaatccaaggaatggggcggcgc
tggccacagccggctggtgttcgacgacagcgaccagcaattgcgcttgcaacttgcgac
cacccaggcagccacgcaactgaacctggggcacctgatccaccaggccgacaactaccg
cggcagcttccgcggggaaggcttcgaactgcgcaccgacgcgtggggcgcggtgcgggc
cagctcggggctatggctgagcagctacggccgcagcggcggcccggccggcgaggcgac
ccagcccagcgcattgctgagccagctgcagacgctgggcaagacgttctcgcaggcggc
gggcacgcaccagacggtgaagctggccgcgcacgaaggcgtgggccaggcgaaccactc
ccagctgatcgccgagcaggcgccgctgccggcgctgctgaccagcgtgaagaccacggt
gccgggcacggcctacgccgacgccaagggcgcggcggccgagcgccgcgccagcccggg
cgacgaccgggtgccgcacaccggcgatgcgctgctgggcctggcggcgccagcggggat
cggcgtggtggccggccagggcctggcgcctggagcgtgggcgagacgctgacgctggcc
agcggcgcgggcagcgaagcggccatcgccggcgacgcccggctgcacagcggccaggca
atcggcgtgctggccgcggcggtggacggccggcaaacgcaagccaacagcctgagcctc
gtcagcggcgaaggcgcgctggacgtgcaggcgcagtcggacgacgtgcgcgtacagtcg
aaagaaggcctgaagctgatcagcgccaacgccgacgtggccctggcggcgggcaagacc
ctccacctggcggtggccggcggggccagcgtgaccatcgaaggcggcaacatcaccgtc
gcctgctccggcaccatcaccgtgcatgcgagcaagaagtcgtttgtggggccggtgcag
catgcgtatccgttgcccgcgttcgcaaagtcggtctgcatcccgtgcctgttgcaggcc
atgggcaaggggcacgcgttgtccccggtgaatgggtga

DBGET integrated database retrieval system