KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3503
Entry
XOO3503           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) VGR-related protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3503 (VgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3503 (VgrG)
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3503 (VgrG)
SSDB
Motif
Pfam: T6SS_Vgr Phage_base_V Phage_GPD
Other DBs
NCBI-ProteinID: AAW76757
UniProt: Q5GX14
LinkDB
Position
complement(3763083..3764609)
AA seq 508 aa
MYELVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQAPQQGQA
PPAQLLLTRVWHAGINNLPVDVRAAVQSQLGVAPAWPDTSAVAARSTWAQAEAVGYGNAF
EAVDRQQPWRPVLADGTGARLHPRPTAPGYQSAIVVGADGSTDGSQEVHADALGRIRVRF
HFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFLPRIGQEVLVGFLEGDIDRPVVLGALYN
GKGEAGVPATPGGTSAEADTGLYAKAGDGRPSAQGNLAGGHAPAWHGAGGGADNHRNATA
LWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADNYRGSFRGEGF
ELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKL
AAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTG
DALLGLAAPAGIGVVAGQGLAPGAWARR
NT seq 1527 nt   +upstreamnt  +downstreamnt
gtgtacgagctggtggggatggacgccttcgccagcgcgcaggcagcagaccgctctgcg
gagttgatggcgcaggcgcacgaggcacagtggtcaccgtggcagggccgcagcacggtg
cgcacgctgcgcgccggcacctggttcacgctgacccaggcaccgcagcagggccaggcg
ccgccggcgcagctgttgctgacgcgggtgtggcatgcgggtatcaacaacttgccggtg
gacgtgcgcgcggcggtgcagtcgcagttgggggtcgcgccggcgtggccggacaccagc
gcggtggccgcacgcagcacctgggcgcaggccgaggcggtgggctacggcaacgccttc
gaggcggtggaccggcagcagccgtggcggccggtgctggccgacggcaccggtgcgcgg
ctgcacccgcggccgaccgcgccgggctaccagagcgccatcgtggtcggtgccgatggc
agcaccgacggcagccaggaggtccatgccgacgcgctgggccggatccgggtcaggttc
cacttccagcacgccgcgtcggccccggcggcgcaggacagcacgtggctgcgggtggcg
cagcgctacgccggcccgggcgtgggcagccagttcctgccacgcatcggccaggaagtg
ctggtgggcttcctggagggggacatcgaccgtccggtggtgctgggggcgctgtacaac
ggcaagggcgaagccggcgttcccgccacccccggcggcaccagcgccgaggccgacacc
ggcctgtacgccaaggccggcgacggcagacccagcgcgcagggcaacctggccggcggc
catgccccggcctggcacggcgccggcggcggcgcggacaaccaccgcaacgccaccgcg
ctgtggggcgtgcaatccaaggaatggggcggcgctggccacagccggctggtgttcgac
gacagcgaccagcaattgcgcttgcaacttgcgaccacccaggcagccacgcaactgaac
ctggggcacctgatccaccaggccgacaactaccgcggcagcttccgcggggaaggcttc
gaactgcgcaccgacgcgtggggcgcggtgcgggccagctcggggctatggctgagcagc
tacggccgcagcggcggcccggccggcgaggcgacccagcccagcgcattgctgagccag
ctgcagacgctgggcaagacgttctcgcaggcggcgggcacgcaccagacggtgaagctg
gccgcgcacgaaggcgtgggccaggcgaaccactcccagctgatcgccgagcaggcgccg
ctgccggcgctgctgaccagcgtgaagaccacggtgccgggcacggcctacgccgacgcc
aagggcgcggcggccgagcgccgcgccagcccgggcgacgaccgggtgccgcacaccggc
gatgcgctgctgggcctggcggcgccagcggggatcggcgtggtggccggccagggcctg
gcgcctggagcgtgggcgagacgctga

DBGET integrated database retrieval system