KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3507
Entry
XOO3507           CDS       T00235                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
SSDB
Motif
Pfam: DUF2345
Other DBs
NCBI-ProteinID: AAW76761
UniProt: Q5GX10
LinkDB
Position
complement(3769541..3770086)
AA seq 181 aa
MLAAAVDGGQTQAHSLSLVSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLH
LAVAGGASVTIEGGNITVACPGTITVHASKKSFVGPVEKSYKLPVPGATPYKLKYVLRDY
TGEPLKSAEYAMYLADGSVVTGKTNAQGETEQVITDGPDSVHLMVSDERHEGYYKVSDGN
A
NT seq 546 nt   +upstreamnt  +downstreamnt
gtgctggccgcggcggtggacggcgggcaaacgcaggcgcacagcctgagcctggtcagc
ggcgaaggcgcgctggacgtgcaggcgcagtcggacgacgtgcgcgtacagtcgaaagaa
ggactgaagctgatcagcgccaacgccgacgtggccctggcggcgggcaagaccctccac
ctggcggtggccggcggggccagcgtgaccatcgaaggcggcaacatcaccgtcgcctgc
cccggcaccatcaccgtgcatgcgagcaagaagtcgtttgtggggccggtcgaaaagtcc
tacaagcttcccgttcccggagcgacgccgtacaagctgaaatacgtgttgcgtgactac
acgggtgaaccgctcaagagcgccgagtacgccatgtatctggctgacggttcggtggtg
accggcaaaacgaatgcacaaggcgaaaccgaacaagtgatcacggatggtcccgacagc
gtgcatctgatggtctccgacgaacgtcacgaagggtattacaaggtgtccgatggcaac
gcatga

DBGET integrated database retrieval system