KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3729Help
Entry
XOO3729           CDS       T00235                                 

Gene name
badH
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo00010  Glycolysis / Gluconeogenesis
xoo00053  Ascorbate and aldarate metabolism
xoo00071  Fatty acid degradation
xoo00280  Valine, leucine and isoleucine degradation
xoo00310  Lysine degradation
xoo00330  Arginine and proline metabolism
xoo00340  Histidine metabolism
xoo00380  Tryptophan metabolism
xoo00410  beta-Alanine metabolism
xoo00561  Glycerolipid metabolism
xoo00620  Pyruvate metabolism
xoo00625  Chloroalkane and chloroalkene degradation
xoo00903  Limonene and pinene degradation
xoo01100  Metabolic pathways
xoo01110  Biosynthesis of secondary metabolites
xoo01120  Microbial metabolism in diverse environments
xoo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO3729 (badH)
   00053 Ascorbate and aldarate metabolism
    XOO3729 (badH)
   00620 Pyruvate metabolism
    XOO3729 (badH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XOO3729 (badH)
   00561 Glycerolipid metabolism
    XOO3729 (badH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO3729 (badH)
   00310 Lysine degradation
    XOO3729 (badH)
   00330 Arginine and proline metabolism
    XOO3729 (badH)
   00340 Histidine metabolism
    XOO3729 (badH)
   00380 Tryptophan metabolism
    XOO3729 (badH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOO3729 (badH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOO3729 (badH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOO3729 (badH)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XOO3729 (badH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAW76983
UniProt: Q5GWD8
LinkDB All DBs
Position
3984106..3985575
Genome map
AA seq 489 aa AA seqDB search
MEAVSETLRGIAARGPLGLFIDGQWSASTGDRHVDVIAQHTQEPLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVDATIGFSKRASQQA
PNLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWKAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARVGLKLGGKSAAIVLEDADSAKVLPTLVPYSMPIAGQVCFSLT
RMLVPAQRRDEILQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVRSYIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEFTPDMTIARGEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMRVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtatccgaaacgctgcgcgggatcgccgcgcgtggtcctctgggcttgttc
atcgatggacaatggagcgcaagcacgggagatcgccatgtcgatgtgatcgcgcagcat
acccaagaaccgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcgacgccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccgaatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaaggcgccgctggtcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggt
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcgggtcggc
ctgaaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacagcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcatgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtttgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcctatattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaattcacaccggacatgaccattgcgcgcggggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcatcgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgcgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system