KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3964
Entry
XOO3964           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3964 (VgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3964 (VgrG)
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3964 (VgrG)
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr Phage_GPD Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: AAW77218
UniProt: Q5GVQ5
LinkDB
Position
complement(4234117..4236273)
AA seq 718 aa
MGIGRQPIGEQQAAHTLVVFDPQAQRPDGGTLRFHRAAISEATDAITAFGAQQRITPTCV
STSSWHSEQLSAVSGHASVEAGELPAVEVYVQPRAGRFAQAAWAQDAAQARLDALRVSAV
LHAGSGSVRTLAAGQTFTLSQHPQYGDQRYTVLALEHSARNNLDTGIAQLLGADGSERGS
YRNRFVAAPAATPLRPLPHDRPQVHGPQTARVVGLPDAAVTPNRDHQVRVQFAWQRGSAP
NPGGLSADDGHAPGDQRSGTWVPVVEWVAGPNRGTHFLPRIGTEVLVEFLHGDIDQPRIT
GQLYNGEVAPPFGGGLPAEQSNHPGTLSGLHTQAHDGSGTQQWLLDDTSGQLRTRLHTSL
ADSTLQLGYLLQGGGAHRGALYGQGFALATQGWGNVHAAQGLLLSTTARAQGTSTQLDVA
EAVSQLKGAARTADALHATLQAQQVPGLDVRTSVSDLHQAIDPQAQGKYSGSVGGQPATK
PAAGSRQGQAPVERFADARLLVESPDHLAWTTPNSAASYAGQQLQLTVQDDLHASAGQTL
AAVVGEHAALFAQTGPLKVIAAAGPVSLQAHGGPLEILADQAVTVTATDTRIDILAQQKI
VLQAGRTSITLEGGNITFACPGTFTVKAGQHPFMGGEVAPLKLEKLPDTRLKRPESFSQK
ITIKGLTPNPFTFLISPIPQPWKLLAIRKTRSGQGVQRSSAVASRGSICFRSNRRLKR
NT seq 2157 nt   +upstreamnt  +downstreamnt
gtgggtattggccgacaaccaataggcgagcagcaggccgcccatacgctggtggtcttc
gacccgcaggcacagcgcccggacggcggcacgctgcgcttccaccgcgccgccatcagc
gaagccaccgatgccatcaccgccttcggtgcgcagcaacgcatcaccccgacgtgcgtc
agcaccagcagctggcacagcgagcaactgagcgccgtcagtggccatgccagcgtcgag
gccggcgagctgccggcggtggaggtctatgtgcaaccgcgcgccgggcgctttgcgcag
gccgcctgggcccaggacgcggcgcaagcgcggctggatgcgctgcgcgtctcggcggtg
ctgcacgccggcagcggcagcgtgcgcaccctggccgccggccagaccttcacgctgagc
cagcatccgcagtatggcgatcagcgctacaccgtgctggcgctggagcacagcgcccgc
aacaatctggacaccggcatcgcgcagctgctgggcgccgatggcagcgagcgcgggagc
taccgcaaccgcttcgtcgccgccccggcggccaccccgttgcgcccgctgccgcacgat
cgcccgcaggtgcacggcccgcagaccgcgcgcgtggttggcctgcccgatgcggcggtc
acgcccaaccgcgaccaccaggtgcgcgtgcagttcgcctggcagcgcggcagcgccccc
aatcccggcgggctgagtgccgacgacggccacgccccgggcgatcagcgcagcggcacc
tgggtgccggtggtcgagtgggtcgccggccccaaccggggcacgcacttcctgccgcgc
atcggcaccgaggtgctggtggaattcctgcacggggacatcgaccaaccccggatcacc
gggcaactgtacaacggcgaagtggccccgccgttcggcggcgggctgccggccgagcag
agcaatcaccccggcacgctcagcggcctgcacacccaggcccacgacggcagcggcacc
cagcagtggctgctggacgacacctctggccagctgcgcacacgcctgcacaccagcctg
gccgacagcacgctgcaactgggctatctgctgcaaggcggcggtgcccaccgtggcgcc
ttgtacggccagggcttcgcgctggccacccagggctggggcaacgtgcatgcggcgcag
gggctgttgctgtcgaccactgcccgcgcccagggcacctcgacccaactggatgtcgcc
gaagcggtgagccagctcaagggtgccgcgcgcaccgccgacgccttgcacgccaccttg
caggcccagcaggtgcccgggctggacgtacgcaccagcgtcagcgacctgcaccaggcg
atcgacccgcaggcgcagggcaagtacagcggcagcgtcggcggccaaccggcgaccaag
cccgcggccggcagccgccagggccaggccccggtggagcgcttcgccgatgcgcggctg
ctggtcgaatcgccggaccacctggcctggaccacgcccaacagcgcggccagctacgcc
ggccaacagctgcagctgacggtgcaggacgacctgcacgccagcgccggccagaccctg
gcggcggtggtgggcgagcacgccgcgctgtttgcgcagaccggcccgctcaaggtgatt
gccgccgccggcccggtgagcctgcaggcgcacggcggcccgctggaaatccttgccgac
caggccgtgacggtcaccgccaccgacacccgcatcgacatcctggcccagcagaagatc
gtgctgcaggccggccggacctccatcaccctggaaggcggcaacatcaccttcgcctgc
ccgggcacgttcacggtcaaggccgggcagcatccgtttatgggcggggaagttgcacct
ctaaaacttgagaaacttcccgatacgagattgaagcgtccagaaagtttcagccaaaag
ataacaataaaagggctaacgcctaatccattcactttcctgattagccccatccctcag
ccatggaagttgcttgccatacgcaaaacgcgctctgggcaaggtgtgcagcgcagcagt
gccgtcgccagccgcggcagcatctgtttcaggtcgaatcggcggttgaagcgatag

DBGET integrated database retrieval system