KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3966
Entry
XOO3966           CDS       T00235                                 

Gene name
VgrG
Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
xoo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xoo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XOO3966 (VgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xoo02044]
    XOO3966 (VgrG)
Secretion system [BR:xoo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOO3966 (VgrG)
SSDB
Motif
Pfam: Phage_GPD DUF2345
Other DBs
NCBI-ProteinID: AAW77220
UniProt: Q5GVQ3
LinkDB
Position
complement(4238868..4240043)
AA seq 391 aa
MRLWSAGSPCWPQCSRCHSKRATHAHIGWLGVFGEFCRGDFGLLAVPPGVYSRPSALKRL
EGYMDISTALAAPSQHARLIQLSSPQPDFVVERFTGTEAVCAGFRFEIDCLSMRNDVDLD
GLLEQPLTLQLRQAAGTMRRWHGLCTAVAALGGDGGLVRYRLTMEPWTALPALGRNAVIF
QDLDTRAICEQLFAAYPQALFRFDVQQTLPARAITTQYRESDWDFATRIDILAQQKIVLQ
AGRTSITLEGGNITFACPGTFTVKAGQHPFMGGESNAADLPPLPEERVPTQTLHLDHRYH
DDQALAGADSAITLANGQQMRGRLDAQGRATVPTIPAGTVDLMFFPMAGLFGRNDMTPTP
NDAVDPSATQLDGVIGKYAIPPAGDTDKGVS
NT seq 1176 nt   +upstreamnt  +downstreamnt
ttgcgcctatggtcggcaggctcgccatgctggccacagtgctcgcgctgtcactcaaag
cgagcaacacacgcccacatcggttggcttggtgtgtttggtgaattttgcaggggcgac
ttcggattgctggccgttccgccgggtgtgtatagtcggccctccgcgctcaagcgtttg
gagggatatatggatatatcgactgcactggccgcaccgtcgcagcacgcccgcttgatc
cagctgtcctcgccgcaaccggacttcgtggtcgaacgcttcaccggcaccgaggccgtc
tgtgccggcttccgtttcgagatcgactgcctgtccatgcgcaacgacgtggacctggac
ggcttgctcgaacagccgctgaccctgcaactgcgccaggccgcgggcaccatgcggcgc
tggcatggcctgtgtaccgcggtggctgcgctcggcggcgatggcggcctggtgcgctat
cgcctgaccatggagccatggacggcgctgccggccctgggccgcaatgcggtgatcttc
caggacctggacacgcgtgcgatctgcgagcagctgtttgccgcctatccgcaggcgctg
ttccgcttcgacgtgcagcagaccctgcccgcacgcgcgatcaccacccagtaccgcgag
agcgactgggacttcgccacccgcatcgacatcctggcccagcagaagatcgtgctgcag
gccggccggacctccatcaccctggaaggcggcaacatcaccttcgcctgcccgggcacg
ttcacggtcaaggccgggcagcatccgttcatgggcggggaatcgaacgccgccgatctg
ccgcccctgccggaggagcgcgttcccacgcagacactccatctggatcatcgctatcac
gatgaccaagcgctggccggcgcggactctgcgatcacactcgccaacgggcagcagatg
cgcggcaggctcgatgcgcagggccgtgccaccgtcccgacgatccccgccggcacagtg
gacctcatgtttttccccatggcgggtctatttggacgcaacgacatgacaccgaccccc
aacgacgccgtcgatccttccgcaacccagttggatggggtgatcggcaaatacgcaatt
cctccggctggcgataccgacaagggagtgtcctga

DBGET integrated database retrieval system