KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO4481Help
Entry
XOO4481           CDS       T00235                                 

Gene name
sodC2
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Brite
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XOO4481 (sodC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AAW77735
UniProt: Q5GU88
LinkDB All DBs
Position
complement(4778189..4778929)
Genome map
AA seq 246 aa AA seqDB search
MSPNGARPLRSPESGRQWLQLRPFFRSTPSEFFRRPLFLATALVLTACKRDEPAPADPAP
APQASTPAEAAHGGEHAASMVTEAAATTTATAELKPTKGNDVKGTVTFKTVDGALRVTGQ
LSGLKPNTEHGFHIHEKGDCSAPDGSSAGGHFNPSQSDHGNVSAEPHHGGDMLNIKSDAQ
GNVTIDGPVSSNVNLAKANQFDIAGHAVIVHADADDYKTQPTGNAGGRLACGVITTDNAQ
AATRYS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccaaacggggcacgcccccttcgcagccctgagtcagggcgtcaatggctgcaa
ctgcggcccttcttcaggagtactccatccgaattcttccgccgccccctgtttctggcc
actgctctggtgctgaccgcctgcaagcgcgacgagccggcaccggccgacccggcaccc
gccccgcaggccagcacgccggccgaagcggcgcacggcggcgaacatgccgcctccatg
gtcaccgaagcggcggccactaccaccgcaaccgccgagcttaagccgaccaaggggaat
gacgtcaaaggcacggtgaccttcaaaactgtcgatggcgcattgcgtgtcaccggccag
ctgagcggcctcaagcccaacaccgagcacggcttccatattcacgaaaagggcgattgc
agcgcaccggacggcagcagcgccggcggccacttcaacccgtcccagtccgatcacggc
aacgtcagcgccgaaccgcatcacggcggcgacatgctcaacatcaagtccgatgcgcag
ggcaacgtcacaatcgacggcccggtgtccagcaacgtcaatctcgctaaggccaaccag
ttcgatatcgccggccacgcggtgatcgtgcatgccgatgcggacgattacaaaacccag
cccaccggcaacgctggcggccgtctggcctgtggcgtgatcaccaccgacaacgcgcag
gcggcgacacgttactcataa

DBGET integrated database retrieval system