KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00716Help
Entry
PXO_00716         CDS       T00763                                 

Definition
(GenBank) P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01130  Biosynthesis of antibiotics
xop01230  Biosynthesis of amino acids
Module
xop_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
xop_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PXO_00716
Enzymes [BR:xop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     PXO_00716
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     PXO_00716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: ACD58776
UniProt: A0A0K0GKE9
LinkDB All DBs
Position
2202241..2203449
Genome map
AA seq 402 aa AA seqDB search
MAPKSNRPTSATGGKSKPARKSAGASVSKQAKTSADTSAIKTAAPVLADVRAKIDEIDRN
IQALIAERANFAHQVGKAKGKLAAAVDYYRPEREAQVLRMVVDRNEGPLSDEVLVHVYRE
IMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVFQEVEAGNADFGV
VPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIERIYAHSQSFAQT
AGWLRSHLPNVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKKVIMKSIEDDDDN
TTRFLVIGRQIFPSSGHDRTSVLVFIHDKPGALFDVLSPFARHGISMNRIESRPSHQDKW
EYGFFIDLVGHVEDDAMKQALAELKAHAAQIKVLGSYPVAIP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagtccaacaggcccacgtccgccactggcggcaaaagcaagccagcgaga
aaatccgcgggcgcttcagtcagtaagcaggcaaagacgtctgccgacacctctgcgatc
aagacagcggcgccggtgctggccgatgtgcgtgccaagatcgacgagatcgaccgcaac
atccaggcgctgatcgccgagcgcgccaactttgcgcatcaggtcggcaaggccaagggc
aagcttgcggcggcggtggattactaccgccccgagcgcgaggcgcaggtgctgcgcatg
gtagtggaccgcaatgaaggcccactcagcgacgaagtgctggtgcacgtctaccgcgaa
atcatgtccgcgtgcctagcccagcaggagccgctgaagatcggttacctcggcccggaa
ggcaccttcagccagcaggcggtgctcaagcatttcggccgctcggcggtggggttgccg
atggccaccatcgaagaagtgtttcaggaagtggaagccgggaatgccgacttcggcgtg
gtgcctgtggaaaattccgggcagggcaccatccaggtcaccctggacatgttcctgacc
tccaacctgaaaatctgcggcgaagtcgagctgcgcgtgcatcagtatctgctctcgcgc
aacggccggctggaagacatcgaacgcatctacgcgcattcgcaatcgttcgcacagacc
gccggctggctgcgttcgcacctgcccaatgtggagaagatcgccgtttccagcaatgcc
gaaggcgcacgccgcgcacgcaatgcagaagatgcggcagccatcggcggcgaaagcgcc
gcgcatgtgtatggcttgaagaaagtcatcatgaagtcgattgaggacgacgacgacaac
accacgcgctttttggtgatcgggcggcagatcttcccctcctccgggcacgaccgcacc
tcggtgctggtatttattcacgacaagccgggcgcgttgttcgacgtgctcagcccgttc
gcgcgccacggcatcagcatgaaccgcatcgagtcgcggccctcgcatcaggacaagtgg
gagtacggcttcttcatcgatctggtcggccatgtcgaagacgatgcgatgaagcaggcg
ctggccgaactgaaagcgcatgcggcacagatcaaggtgctagggtcgtatccggtggcc
attccctag

DBGET integrated database retrieval system