KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02037
Entry
PXO_02037         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB
Other DBs
NCBI-ProteinID: ACD60340
UniProt: A0A0K0GNA1
LinkDB
Position
3877294..3879549
AA seq 751 aa
MTSMLISYPILPANAANQSDQAKFDAMVALTQPTRGLYPITTGNRWHGGIHLTPGTEPIR
AIADGVIVAYRLAPATKDYPGQGLYDTSFVLIKHDTHSGENTQVVYYSLYMHLAPKGSLT
DAQRSQMMPFLRNAATGESATQAPANTRVWRKEVLGFGGQLYGVPTVHFEIFTTEADLAR
FWRDASAVAAGGHGSNDVFGDTHFILPANLNFVARHPHAVAPHRIDVPGHNQFYELPIGI
AGQSTERLHVVVELSKGHRIATTYRLDAQGKLAGQIGLPLRQDDYEYEIFRLATKLYADC
PSAGYEYLRFGRILSSDTTTHTENWQLIRYAENAIGYINLADPGNNVIVLSDADFPDSWQ
KLSEGRAASPEDGIANVDGLTQLLNLPASPSEPSLSAAPSFLSRASDASVIKLLRHFICK
HPSEWDTSDIDTRYAVLKQPGKPLNDPTAWKNFKDHVEAMAFWPQTGLADRSVWHFHPLT
FINHYMKCGWLSVNEFARCLPRRSLSDRNLVWNTALTRATTHSIHYNKYIRKFCGNSRKR
LAHNLAQSYIETGILSLMEEGGAGNGHPYTAFFGRGYHQLTWAGNYRGYGEFKNLPQHTG
AYSDRRITRTSQHPLDSGGTLITWSPRYDPATISSDLDHAGESSGFFWASKSFRGKKNMN
RVADLEFNESSVGFCCWLINGGGAGYSNRQQFAKFLANILLDEPLKSGQVNFTYPALSPP
GNPALCTSFPPATVPYTERQIIDYEPQIPPV
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgacatcaatgcttatcagctatcccattttgcctgccaacgcagccaatcaaagcgac
caagcaaagttcgatgcgatggtggcgcttacacaaccgaccagaggactctacccaatc
acaacgggaaaccgctggcacggcggcatccaccttacaccgggaaccgagcccatacgt
gcgatcgctgatggcgtcatcgtcgcctatcgcctggctccggcaaccaaagactatcca
ggacagggcctttacgacaccagtttcgtgctgataaagcacgatacgcatagcggtgaa
aacacgcaggtcgtgtactactcgctatacatgcacctcgccccgaaaggctcgcttacc
gacgctcagcggtcacagatgatgccgttcctgcgaaatgcggcaactggcgaatcggcc
acgcaagcacctgccaatacccgggtttggcggaaggaagtactcggcttcgggggccag
ctttacggcgtaccgacggtgcacttcgaaatattcaccacggaagcagaccttgcgagg
ttctggcgggacgccagcgctgtcgctgcaggtggacatggctccaatgatgtcttcggg
gatacccacttcatcctcccggccaatctcaacttcgtagcacgccatccgcatgccgtc
gctccacaccgcatagacgtacccgggcataaccaattctacgaactgcccattggcata
gcaggccaaagcactgaacgcctacacgtggtagtagaactaagcaaaggacatcgcatt
gctaccacttatcgcttggatgctcaaggaaagctcgcagggcagatcggtctccccttg
aggcaagatgactatgagtacgaaattttccgactggcaacgaaactttacgcggattgc
ccaagtgcaggatatgaatacctgcgctttggtcgtattttgagcagcgacacaacaacg
catacagaaaactggcaattgatccgatatgccgaaaacgctatcggctacatcaacttg
gctgatcctgggaataacgtcattgtactttcggacgcggactttcctgactcttggcaa
aagctatccgaaggccgggcagcgagccctgaggatggcatcgcaaacgtagatggctta
actcaacttcttaacttacctgcatcgccatctgagccatccttgtcggctgcaccaagc
tttctgtcacgggctagtgacgccagtgttattaagctgctgcggcattttatttgcaaa
catcctagtgaatgggatacaagcgatatcgacaccagatatgccgtgctgaagcaaccg
ggtaagccacttaacgatcccactgcttggaagaacttcaaagaccacgttgaagcgatg
gcgttttggcctcagacaggcttagcagaccggagcgtctggcatttccatcctttgact
ttcataaaccactacatgaaatgtgggtggcttagcgttaatgagtttgctagatgctta
ccaagacgcagcctttcagatcgcaacttagtctggaatacggcattgactagggcaacg
acacattcgattcattacaacaaatacatacgcaagttttgtggcaactccagaaaaagg
ctcgctcacaacctagcccaaagttatatcgaaacgggaattttatccttaatggaagaa
ggaggagccggcaatgggcatccgtatactgctttttttggcaggggctaccatcagtta
acatgggctggcaattatcgaggatacggcgagttcaaaaacctcccacagcatacaggc
gcttactctgacagaagaattacccgaacatcacagcaccccctggactcgggaggaaca
cttatcacatggtcaccacgctatgatccggcgacaatctcatccgacctcgatcacgct
ggagaatccagtggatttttctgggcatccaaaagctttcgaggcaaaaaaaatatgaac
cgagttgcggacttggaatttaatgagtcatcagtagggttctgttgctggcttattaat
ggtggtggggcaggctattctaaccgacagcaatttgctaagtttctcgccaacatcctt
cttgacgaaccattaaaatctggccaagttaactttacctaccccgcattgtcaccacca
gggaaccctgcactctgtaccagcttcccccctgcgacagtcccttacacagaaaggcag
atcatcgattatgaacctcaaattcctcctgtgtag

DBGET integrated database retrieval system