KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02038
Entry
PXO_02038         CDS       T00763                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PXO_02038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02038
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02038
SSDB
Motif
Pfam: DUF2345 T6SS_Vgr Phage_base_V DUF4178 Sarcoglycan_1
Other DBs
NCBI-ProteinID: ACD60339
UniProt: A0A0K0GMS6
LinkDB
Position
3875857..3877290
AA seq 477 aa
MPAATPLRALPQDRSRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPTPGGLTD
SASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQL
YNGEVAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTR
LELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVA
QLHGAQRTAQALHATLTQQQVPGLDAHPSVTQLREAIDPQAQGKYTAAVGGQAATKPADG
GRDGQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVS
GQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRIDVLAQHKIVLQA
GQTRITLEGGDITFACPGQFTVKASMHPFLGGESGSAALPPLPDSLKKPDGTAPFSV
NT seq 1434 nt   +upstreamnt  +downstreamnt
gtgccggcggccacgcccttgcgcgcgctgccgcaggaccgctcgcgcatgcccgggccg
cagagcgcgcgcgtggtcggcgtggccgacgcggcgctgagcccgagccgcgaccaccag
gtgcggatccagttcccgtggcagcgcggcgaccagcccaccccgggcgggttgaccgac
agcgccagcaccgcgcccggccacgcgccgggcgaccagcgcgccggcacctgggtgccg
gtggccgagtgggtggccggcccgaactggggcagccacttcctgccgcgcatcggcagc
gaagtgctggtggagttcctgcacggagacatcgatcagccgcgcatcaccggccagttg
tacaacggcgaggtcgccccacccttcggcggcggcctggacgcgcgtgccagccacccc
ggcacgctcagcggcctgcacacccagtcccacgacggcagcggcacccagcaatggctg
ctggacgacacccccggccagctgcgcacgcgcctgcacacctcgctggccgacacccgg
ctggaactgggctacctggtccagcacagcgacaccgcccgcggcgcgctgcgcggccag
ggcttcgaactggcctcccagggctggggcaacgtgcatgccgcgcaaggcctgctgctg
tccagcagcgcccgcggccagggcgcctcgaccgcattggacgtggccgaggcggtggcc
cagttgcacggcgcccaacgcaccgcccaggcgctgcacgccaccctgacccagcaacag
gtgcccggcctggacgcccatcccagcgtgacccaactgcgcgaggccatcgacccgcag
gcgcagggcaagtacaccgctgcggtcggcggccaggcggcgaccaagccggccgacggc
ggccgcgacggccaggcaccggtggaacgcttcgcccaggcgcgcctgctcggcgagtcg
ccggaccacatcgcctggaccaccccggccagcgcggtggcctatgccgggcaggccctg
cagttgaccgtgcagcaggatgcgcagctgagcgccgggcagaccctgtcggcggtgtcc
ggccagcacaccgcgctgttcgcccaacgcgggccgatcaaactcatcgccgccgccggc
ccggtgagcctgcaggcacataccggcgcgctggaactgctggccgaccaggcggtgacc
gtcaccgccaccgacacccgcatcgacgtgctggcgcagcacaagatcgtgctgcaggcc
ggacagacccgcatcaccctggaaggcggcgacatcaccttcgcctgcccggggcagttc
acggtcaaggccagcatgcatccgttcttgggtggggagagcggcagtgccgccctgccg
cctttgcctgacagcttgaagaagcccgatggcactgcacctttctccgtctaa

DBGET integrated database retrieval system