KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02039
Entry
PXO_02039         CDS       T00763                                 

Definition
(GenBank) EF hand domain protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB
Motif
Pfam: Glyco_hydro_19 EF-hand_6
Other DBs
NCBI-ProteinID: ACD60338
UniProt: A0A0K0GNJ7
LinkDB
Position
3872128..3875022
AA seq 964 aa
MADTEQKKLAKISKLVHPFQKSAKAGKAGAKPTDIDDPQVYFDALSNAQDGFYPIGANGQ
WHGGIHFDTQTGNTLAQEDGIRCIGDGEVVAYQIDAKYPSIEYSAGKATYSRGFVLVRHR
LELPPAPKQTTQPAPAGPSAANTAPATPQPVAQPAATLDQKAQEPSLIFYSVYLHLLDWA
GYQADPKKPRPAFWKSVAYMVGDKAKDSDRVSNPSIPEGGVGLNLRDAQHQKVGYAPRGA
KLRLGAENPNKKGYFVISEVVSGQTVPADAKGLYAYKAELTAAGAEPDRQDAVYVLPTPA
PIKAGDLIGYLGHYQRFADLTPLAAAGPAQNGVRPLIQLDVFTAEDLKTFIAKSRERAKL
LDAKQKTLLKIDVGAKLVLPSEPDQQIGAEEAAAVVPGGKVGAWVQVRKGTLQIMDKDSL
SGFNSTTHTYGGGQILHRVLGASDSDSITEAAYNALKTKEEKDKYPRRQVLVPSGAPVWV
DKAMMGADASVADRSLKAWSTFPLQASQANGPEAGFIRVAAIKTLKKVATEPDGTRWWEV
DVGKIDGSSAVGWAREKDHAKVTRCSPWEWPGFEFIEADGTTPEALYARHVVATKQAKPD
EQAALEAKAAQANGGPLFSRVCDAIDLDDDRHLTPAELRKALKQPWLAEAISRLVFHHTS
EWGTPRAQWNAIDGDIPESRKADWEKEKDRIESLQWWSDVKTTPALPGDAKVYAFHPIGL
ISNFSSPSECCQLTMASFRSIFGDRKIFNHRDMPRGGDTYEADIQKFIDLLNDGFSKNGF
ETCIYKQHFLAQCYHESDHFNTTIEYASGLDYDLSKYPTSVCDVNSSEYDKKKCRRRNQI
IQEGNTTIGDGPTYKGKGIIQLTWKGTYNAYKEYSGSDVVSNPMKVAEDLATAVSTAFWF
WAKFKGEDLNRKIDRYYEEGAKSGLNSEALDDDVVRRLTKIINGGDRGLSERQNLLKKIK
KEMQ
NT seq 2895 nt   +upstreamnt  +downstreamnt
atggcagataccgagcagaagaaactggcgaagatcagcaaattagtccatccgttccag
aaaagcgcaaaggcaggcaaggccggcgccaagccgaccgacatcgacgatccgcaggtc
tatttcgatgcgctttccaacgcacaggacgggttctaccccatcggtgccaacgggcaa
tggcacggcggcatccatttcgatacgcaaaccggcaacaccctggcgcaggaagacggc
atccgctgcatcggcgatggcgaggtcgtggcgtaccagatcgatgcgaagtaccccagc
atcgagtacagcgccggcaaggccacctactcacgcggcttcgtgctggtccgccaccgc
ctggagctgccgcctgcgcccaagcagaccacgcagcctgcccctgctggaccgagcgcg
gccaacacggcaccggctacgccacagccggtagcccagcctgcggcaacactcgatcag
aaggcgcaagagccttcgctgatcttctacagcgtctatctccacctgctcgactgggcc
ggctaccaagccgatccgaagaagccgcgcccggcgttctggaagagcgtggcctatatg
gtcggcgacaaggccaaggacagcgacagagtctctaacccttccattccggaaggaggc
gtaggccttaacctgcgcgacgcgcagcatcagaaggtcggctatgcgccacgcggcgcc
aagctgcggcttggcgccgaaaatcccaacaaaaagggctatttcgtcatctccgaggtc
gtcagcgggcagaccgttcctgccgacgcaaaaggcctgtatgcctacaaggcagagctg
accgccgccggcgccgagcccgaccgccaggacgcggtctatgtgttgccaacccccgcc
ccgatcaaagccggcgacttgatcggctatctcggtcactaccagcgctttgccgatctc
acgccattggcggcagccggccccgcgcagaatggcgtgcggccactgatccagttggac
gtattcaccgcagaagatctcaagaccttcatcgccaagagccgtgagcgggcgaagctg
cttgatgccaagcaaaagaccctgctcaagatcgacgtgggcgccaagcttgtgctgcca
agcgaaccggaccagcagatcggcgccgaggaggctgccgccgtggtccccggcggcaag
gtcggagcctgggttcaggtgcgcaaaggcaccttgcagatcatggacaaggacagcctg
agcggcttcaacagcaccacccacacctacggcggcggccagatcctgcatcgcgtgctc
ggtgccagcgatagcgacagcatcaccgaagcggcctacaacgcgctgaagaccaaggaa
gaaaaagacaagtacccgcgccgccaggtactcgttcccagcggcgcgccggtgtgggtg
gacaaggcgatgatgggcgccgacgccagcgtcgccgaccgctcgctcaaggcgtggagc
acgttcccgctacaggccagccaggccaacggaccggaggcgggcttcatccgcgtcgcc
gccatcaagacactgaaaaaggtcgcgaccgaaccggacggcacccgctggtgggaagtg
gatgtgggcaagatcgacggcagcagcgccgtgggctgggccagggagaaggaccatgcc
aaggtcacccgctgctcgccgtgggagtggccgggtttcgagttcatcgaagccgacggc
actacgccggaagcgctgtacgcacgccacgtggtcgccaccaagcaagccaagcctgac
gagcaggccgctttggaagccaaggccgcacaagccaatggaggcccgctgttctcgcgc
gtatgcgacgccatcgacctggacgacgaccgtcatctcacccccgcagaactgcgcaag
gccctgaaacagccctggttggcggaggcgatttcccgcctggtcttccatcacacaagc
gaatggggaacgccgcgtgcgcaatggaacgcgatcgacggcgatatcccagaatcgcgc
aaggcggattgggagaaggaaaaggatcggattgaaagcctgcagtggtggagcgacgta
aaaaccactccggctttgccgggggatgccaaggtttatgctttccatcctattgggttg
attagtaatttttcttctccatcggaatgctgccaacttaccatggcatcgtttcgatct
atttttggagaccgaaagatattcaaccatcgcgacatgccacgcggtggtgacacatac
gaagctgacatacaaaaatttattgacttactcaatgatggattttcaaaaaatggtttt
gaaacgtgcatttataagcagcactttctcgcacagtgctatcacgaaagcgatcacttt
aacaccaccatagaatatgcaagcggtctagactacgacttatcaaaatatccaacttcc
gtgtgcgatgttaatagctcggaatacgacaagaagaaatgcaggcgccgcaaccagatc
atacaagaaggtaataccactattggcgatggaccaacctataagggaaagggaatcatt
cagcttacgtggaaaggcacgtacaatgcctacaaggaatactctggctcggatgttgtg
agcaacccaatgaaggtagccgaagatctagccacagctgttagtacggcattttggttc
tgggcaaaatttaaaggagaggacctcaatagaaagatagatcgctattacgaagaaggg
gctaaatccggccttaattcggaagcccttgatgatgacgttgttagaagattaaccaag
ataattaacggaggagatagagggctttccgaacggcaaaatttgcttaagaaaattaaa
aaggaaatgcaatga

DBGET integrated database retrieval system