KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02042
Entry
PXO_02042         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02042
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02042
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ACD60335
UniProt: A0A0K0GN97
LinkDB
Position
3867460..3868761
AA seq 433 aa
MRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGES
YDAPAHDALPDALSLNDLPAGIQTTTVYLALPLLRDDGGNCSDAEGSQLARYQQLNRPTS
DLYTDAAQSELAYLSKAVKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHID
ASPTLYRELRGLLDSLQAKVDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSH
LFHHPQLHPERLYQELLRMAGALLTFSNAYQLNDLPRYNHAAPEACFQRLFQIVRDLLDT
VISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVSADMPGPELVQTVPVRFKIGAP
DDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLKAQSMMLYVPSG
IDDLKMELVAVTS
NT seq 1302 nt   +upstreamnt  +downstreamnt
ttgcggccgcagcatttccagcgccaggacacctaccacgaagcaaggctgcaggatctg
gcgcagacgctgcatccctatggctggggaacgcgccggatccgtttcgatccgcagagc
atggctagcggcagcttgcgcgcgctcgccctgtcggtggtctttcccgatggcgaatcg
tacgacgcgccggcgcacgacgcgctgcccgatgcgctgtcgctgaatgacctccccgcc
ggcatccagaccaccacggtgtacctggcgctgccgttgctgcgcgacgacggcggcaac
tgtagcgatgcggagggttcgcaactggcccgctaccagcagctcaaccggccgaccagc
gacctgtacaccgacgcggcccaatcggaactggcgtacctgagcaaggcggtgaagctg
ctcaccgacgacactccgcgcgatccgtacgtgaccgtgccggtggcgcgcgtgcgccgt
accccgaccggcggcttcgagctggacgaggacttcatcccgtcatgcgcacacatcgac
gcctcgccgacgctgtatcgcgaactgcgcggcctgctcgactcgctgcaggccaaggtc
gacgcgctgtacgggctgcatcggcaatcgtcgcagcacatcatcgaattccgctccggc
gacatcgcctcgttctggctgctgcataccgcctgttcctcgttcggcgcgctgtcgcac
ctgttccatcatccgcagctgcaccccgagcgcctgtaccaggaactgctgcgcatggcc
ggcgcgttgctgacgttctccaacgcctaccagctcaacgacctgccccggtacaaccac
gcggcgccggaagcctgcttccagcgcctgttccagatcgtgcgcgacctgctcgacacg
gtgatctcggcgcgctacttcaagatcgcgctgaccgaggtcaagccgtcgttccacctg
ggccggatcgattcgcagcggatcgacgagaacgccgcgttctacctgagcgtgtcggcc
gacatgcccgggccggaactggtgcagacggtgccggtgcggttcaagatcggtgcgccg
gacgacgtcgagaagtgcgtgctgtcggccctgccgggcgtgaagctgacccacgccgcg
caggtgccggcagcgatcccggtccgtcccggcagctactatttcgccctggaagcgcgc
gggccgctgtacgagcgcatgctcaaggcgcagtctatgatgctctatgtgccgtcaggc
attgatgacctcaagatggaacttgtcgcggtaacctcatga

DBGET integrated database retrieval system