KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02043
Entry
PXO_02043         CDS       T00763                                 

Definition
(GenBank) lipoprotein, putative
  KO
K11906  type VI secretion system protein VasD
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PXO_02043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02043
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02043
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ACD60334
UniProt: A0A0K0GMS1
LinkDB
Position
3866667..3867275
AA seq 202 aa
MNISAHRFNFLLVLIVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPMIPLRLFAG
SNLNAGSDTHATAAVVKIYHLRSAQRFEQAAFNAFLDQAGEQAALGADLLSVNEIVLTPS
ARQELNEQMSEGTTTLGVVGLFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASP
ALVTRLAGDPSSLASVRCAAAR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaacatatccgcccaccgtttcaattttctgttggttcttattgtagccgccctagcc
ctgtcaggctgcgccagcggcggcatcggcaaggcgatggacaagaccctgcaggcagtg
ggcatcaaggaagcaaagccagaggcgtctccgatgattcccctgcggctgtttgccggc
agcaacctgaatgcgggcagcgacacgcacgccaccgcagcggtggtcaagatctatcac
ctgcgcagcgcgcaacgcttcgagcaggccgcgttcaacgcgttcctcgatcaggccgga
gagcaggcggcgctgggcgcggacctgctgtcggtcaacgagatcgttctgacgccaagc
gcccgccaggaactgaacgagcagatgtccgaaggcaccaccaccctgggcgtggtgggc
ttgttccgcgcgccggccgagggccgctggcgcatggccttcgatacgcgacgcaaggaa
ttgccgacccagggcatcaccatcggcattcacgcctgcgcgctgaccaccgccagcccg
gcgctggtcacccgcctggcgggcgatcccagcagcctggcgtcggtgcgttgcgccgct
gcgcgctag

DBGET integrated database retrieval system