KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02045
Entry
PXO_02045         CDS       T00763                                 

Gene name
evpA
Definition
(GenBank) EvpA
  KO
K11901  type VI secretion system protein ImpB
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02045 (evpA)
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02045 (evpA)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACD60332
UniProt: A0A0K0GNB3
LinkDB
Position
complement(3865245..3865745)
AA seq 166 aa
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDR
KFVNVDLDNFDEVMEGMAPRAVYRVPNKISDAGGEFRVELKFKSIDDFRPEAVVDQVEPL
RKLLESRTKLADLRNKLAGNEKLEDLLTDVLNNTEQLKKLGREKEK
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctaagaaggaaagcatccagaaacgtctgcagaagattcggccgccgcgcgtgcag
ctgacctacgacgtggaaaagggtgacgcgatcgaacagaaggagctgccgttcgtggta
ggcgtgcttggggatttcagcggcaatcccgaacagcccctggccaaggtcaaggaccgc
aaattcgtcaacgtcgacctcgacaacttcgacgaggtgatggagggaatggcgccgcgc
gcggtttaccgtgtgccgaacaagatcagcgatgccggcggcgagttccgcgtcgaactc
aagttcaagtcgatcgacgacttccgtccggaggctgtggtcgatcaggtcgaaccgctg
cgcaagctgctggaatcgcgcaccaagctggcagacctgcgcaacaagctggccggcaac
gagaagctcgaagacctgctaacggacgtgttgaacaacaccgaacagctgaagaagctg
ggtcgggaaaaggagaagtaa

DBGET integrated database retrieval system