KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02046
Entry
PXO_02046         CDS       T00763                                 

Gene name
evpB
Definition
(GenBank) EvpB
  KO
K11900  type VI secretion system protein ImpC
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02046 (evpB)
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02046 (evpB)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ACD60331
UniProt: A0A0K0GN61
LinkDB
Position
complement(3863745..3865241)
AA seq 498 aa
MAAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVV
SDNLNLTLDARIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVF
NSPQRDLVRDFKSAIDFDQSALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQ
MSHVAAAAHAPFISAASESMFGLETFTDLGKPRDLAKVFDTVEYAKWKSFRESEDSRYVG
LTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWCNTAYAMATRLTKAFEDYGWC
AAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNTD
YAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDE
LSVSLRLVAELPAGTKKA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggccgcagaggtttcgagtgccacccacaattcggcgcccgccgcgctggcagaaaca
ggcttgctcgaccagatcgtcgagcagagcaaggtcgccaaatcggagaccgagcaccag
cgtgcgaaggacatcatctccgagctggccaaggaggtgctggaaggtaccgtcgtggtg
tcggacaacctcaatctgacgctggacgcgcgcattgccgagatcgatcggatcatctct
gagcagctgagcgcggtgatgcatgcgccggagttccagaagctggagagcagctggcgc
ggcctgcactacatgtgcgagcagacgtccaccggcgtgacgatgaagatcaaggtcttc
aactcgccccaacgggatctggtgcgcgacttcaagtcggcgatcgacttcgatcaaagc
gcgctgttcaagaaggtctacgaggaagagttcggcaccttcggcggtgcgccattcggc
gcactggtcggcgactactacatcggccgccagccggaggacatgtacttcgtcgagcag
atgtcgcatgtggccgccgcggcgcacgcgcccttcatctctgccgcgtctgaatcgatg
tttggtctggaaaccttcaccgacctgggcaaaccgcgcgatctggccaaggtgttcgac
actgtcgaatacgccaagtggaagtcgttccgtgagtcggaggatagccgctacgtcggc
ctgaccatgccgcgttttctcgggcggctgccgtacaacccgaaggacggcactacggtc
gaaggcttcaacttcgtcgaagacgtcgacgctgccgaccatagcaagtatctgtggtgc
aacaccgcttatgcgatggccacgcgcctgaccaaggcgttcgaggactacggttggtgc
gcggcgatccgcggtgtggaaggcggtggcctggtcgaagacctgccgacccacaccttc
cgcaccgacgacggcgaagtggcgctgaagtgcccgaccgagatcgcgatcaccgaccgc
cgcgagaaggaactcagcgacctgggcttcatcccgctggtacattgcaagaacaccgac
tacgcggcgttcttcggtgcgcagtcggcgcagaagccgaagaagtacaacaccgatgcg
gccaatgccaacgcgatcctgtcggcgcagctgcagtacatgttcgccgtgtcgcgtatc
gcccattacctcaaggcgatgatgcgcgagaagatcggcagtttcgcctcggcgcgtaat
gtcgaggacttcctgaaccgttggatctcccagtacgtgttgttggacgacaacgccggt
caggaagcaaaggcgcaataccccttgcgggaagcgtccgtacaagtttcggaagtgccg
gggaaacccggtgtctaccgcgcggtggccttcatcaggccgcatttccagctcgatgag
ctgtctgtttcgttgcgtctggtggccgaactgccggctggtaccaagaaggcgtag

DBGET integrated database retrieval system