KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02772Help
Entry
PXO_02772         CDS       T00763                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00473  D-Alanine metabolism
xop00550  Peptidoglycan biosynthesis
xop01100  Metabolic pathways
xop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PXO_02772
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PXO_02772
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PXO_02772
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xop01011]
    PXO_02772
Enzymes [BR:xop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PXO_02772
Peptidoglycan biosynthesis and degradation proteins [BR:xop01011]
 Precursor biosynthesis
  Amino acid ligase
   PXO_02772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACD61441
UniProt: A0A0K0GRC1
LinkDB All DBs
Structure
PDB: 

Position
complement(5023772..5024881)
Genome map
AA seq 369 aa AA seqDB search
MRKIRVGLIFGGKSAEHEVSLQSAGNILDALDPQRFEPVLIGIDKQGQWHVNDPDSFLLH
ADDPARIALHRSGRGVALLPGAQQQQLRPIQPEQALALAQIDVVFPIVHGTLGEDGSLQG
LLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFVCFDRHTAAHADVDTLIAQL
GLPLFVKPANQGSSVGVSQVRTADAFAAALALALAYDHKVLVEAAVAGREIECAVLGNAV
PHASVCGEVVVHDAFYSYATKYISEHGAEIVIPADIDAQTQQRIQQIAVQAYQALGCAGM
ARVDVFLCADGRIVINEVNTLPGFTRISMYPKLWQASGLDYRGLITRLIELALERHTDDQ
LLRSAVELH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagatccgggtcggcctcatcttcggcggcaaatcggccgagcacgaggtttcg
ttgcaatcggcgggcaacatcctggatgcgctggacccgcaacgcttcgagccggtgctg
attggtatcgacaagcaaggccaatggcacgtcaacgaccccgacagcttcctgctccat
gccgacgacccggcacgtattgcgctgcatcgcagtggtcgcggggtggcactgctgccg
ggcgcgcaacagcagcaattgcggcccatccagccggagcaggcgctggcgctggcgcaa
atcgatgtggtgttccccatcgtgcacggcaccttgggcgaagacggctcgctgcagggg
ctgctgcgcatggccaacctgcccttcgtgggctccggcgtgctgggctcggcggtggcg
atggacaaggacatggccaagcgcgtgttgcgcgatgccaggctggcggtggcaccgttc
gtctgcttcgaccgccacaccgccgcgcacgccgatgtggatacgttgatcgcgcagctg
ggcttgccgttgttcgtcaaaccggccaaccagggctcatcggtcggcgtcagccaggtg
cgcacggccgacgcattcgctgctgcactcgccttggcgttggcctatgaccataaggtg
ctggtggaagcggccgttgccgggcgcgaaatcgaatgcgccgtgctgggcaatgccgtg
ccacacgcaagcgtctgcggcgaagtggtggtgcacgacgcattctattcgtacgcaacc
aaatacatcagcgaacacggtgccgagatcgtgattccggccgacatcgatgcgcagacc
cagcaacgcatccagcagatcgcagtgcaggcctaccaggcgctgggctgcgcaggcatg
gcgcgcgtggacgtctttttgtgcgccgatgggcgcatcgtgatcaacgaggtcaacacg
ctgccaggcttcacccgcatcagcatgtatccgaaattatggcaggcaagcgggctggac
tatcgcggtctgattacgcggttgatcgagctcgcactggaacggcacacagacgaccaa
ctgctgcgcagcgcggtcgagctacactga

DBGET integrated database retrieval system