KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04627Help
Entry
PXO_04627         CDS       T00763                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop00053  Ascorbate and aldarate metabolism
xop00071  Fatty acid degradation
xop00280  Valine, leucine and isoleucine degradation
xop00310  Lysine degradation
xop00330  Arginine and proline metabolism
xop00340  Histidine metabolism
xop00380  Tryptophan metabolism
xop00410  beta-Alanine metabolism
xop00561  Glycerolipid metabolism
xop00620  Pyruvate metabolism
xop00625  Chloroalkane and chloroalkene degradation
xop00903  Limonene and pinene degradation
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_04627
   00053 Ascorbate and aldarate metabolism
    PXO_04627
   00620 Pyruvate metabolism
    PXO_04627
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PXO_04627
   00561 Glycerolipid metabolism
    PXO_04627
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PXO_04627
   00310 Lysine degradation
    PXO_04627
   00330 Arginine and proline metabolism
    PXO_04627
   00340 Histidine metabolism
    PXO_04627
   00380 Tryptophan metabolism
    PXO_04627
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PXO_04627
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PXO_04627
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PXO_04627
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PXO_04627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACD57787
UniProt: A0A0K0GI33
LinkDB All DBs
Position
complement(1159062..1160531)
Genome map
AA seq 489 aa AA seqDB search
MEAVSETLRGIAARGPLGLFIDGQWRASTGDRHVDVIAQHTQEPLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVDATIGFSKRASQQA
PNLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWKAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARVGLKLGGKSAAIVLEDADSAKVLPTLVPYSMPIAGQVCFSLT
RMLVPAQRRDEILQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVRSYIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEFTPDMTIARGEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMRVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtatccgaaacgctgcgcgggatcgccgcgcgtggtcctctgggcttgttc
atcgatggacaatggcgcgcaagcacgggagatcgccatgtcgatgtgatcgcgcagcat
acccaagaaccgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcgacgccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccgaatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaaggcgccgctggtcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggt
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcgggtcggc
ctgaaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacagcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcatgctggtgccggcacagcgccgagatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtttgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcctatattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaattcacaccggacatgaccattgcgcgcggggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcattgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgcgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system