Xanthomonas oryzae pv. oryzicola BLS256: XOC_0180 Help Entry XOC_0180          CDS       T01873                                  Symbol trx Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism xor  Xanthomonas oryzae pv. oryzicola BLS256 Brite KEGG Orthology (KO) [BR:xor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:xor03110]     XOC_0180 (trx) Chaperones and folding catalysts [BR:xor03110]  Protein folding catalysts   Protein disulfide isomerase    XOC_0180 (trx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_9 Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AEQ94428 UniProt:  G7TJM6 LinkDB All DBs Position complement(179970..180242) Genome browser AA seq 90 aa AA seqDB search MGFVREYATQAPERSAVDTRAGLQILEFGTDWCGHCMAAQPLLHTLLGGYEAIDYRKIED GKGRPLGRSFRVTLWPTIILLRDGQELARA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggggttcgttcgcgagtacgccacccaggcaccggaacgcagcgcggtggatacacgg gccgggctgcagatcctggaattcggcaccgactggtgcggccactgcatggctgcacag ccgctgctgcacacgctgttgggcggatacgaggcgatcgactatcgcaagatcgaagat ggaaaagggcggccgcttggccgctcttttcgcgtcacgttgtggcccacgatcatcctg ctgcgcgatggccaggaactggcgcgcgcgtga

DBGET integrated database retrieval system