KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0299Help
Entry
XOC_0299          CDS       T01873                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Brite
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XOC_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 Glyco_hydro_81 CHRD
Motif
Other DBs
NCBI-ProteinID: AEQ94538
UniProt: G7TKM1
LinkDB All DBs
Position
296855..297502
Genome map
AA seq 215 aa AA seqDB search
MRILPTPLFLATALMLTACKRDEPAPTDPAPAPQASTPAEAAHGGEHAASMVTEAAASTT
ATAELKPTKGNNVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSDHGNVSAEPHHGGDMLNIKSDAQGNVTIDGPVSSNVNLAKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAATR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattcttccgacccccctgtttctggccactgctctgatgctgaccgcctgcaag
cgcgacgagccggcaccgaccgacccggcacccgccccgcaggccagcacgccggccgaa
gcggcgcacggcggcgaacatgccgcctccatggtcaccgaagcggcggccagtaccacc
gcaaccgccgagcttaagccgaccaaggggaataacgtcaaaggcacggtgaccttcaaa
actgtcgatggcgcattgcgtgtcaccggccagctgagcggcctcaagcccaacaccgag
cacggcttccatattcacgaaaagggcgattgcagcgcaccggacggcagcagcgccggc
ggccacttcaacccgtcccagtccgatcacggcaacgtcagcgccgaaccgcatcacggc
ggcgacatgctcaacatcaagtccgatgcgcagggcaacgtcacaatcgacggcccggtg
tccagcaacgtcaatctcgctaaggccgaccagttcgatatcgccggccacgcggtgatc
gtgcatgccgatgcggacgattacaaaacccagcccaccggcaacgctggcggccgtctg
gcctgtggcgtgatcaccaccgacaacgcgcaggcggcgacacgttaa

DBGET integrated database retrieval system